Conserved Protein Domain Family
phasin_3

?
TIGR02809: phasin_3 
phasin family protein
Members of this protein family are encoded in polyhydroxyalkanoic acid storage system regions in Vibrio, Photobacterium profundum SS9, Acinetobacter sp., Aeromonas hydrophila, and several species of Vibrio. Members appear distantly related to the phasin family proteins modeled by TIGR01841 and TIGR01985.
Statistics
?
PSSM-Id: 131856
View PSSM: TIGR02809
Aligned: 3 rows
Threshold Bit Score: 157.067
Threshold Setting Gi: 499539652
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000287820   4 EFFKTFSDQTEKNFEPYIKFNKLVTKNVEVLTELQLNAIRTYSELGLAQMKAASEIKDVTSLTAFNSQQLGVLNKLSQQM 83  Vibrio
WP_011706254   4 DVIKTFTEQMQGFAAPLTRYNQLLASNIEQLTRLQLASANAYAELGLNQLQAAGKVQDAQSLAALGTVQLETASQLSRQM 83  Aeromonas hydro...
WP_011220435   4 EMFKSFSEQTEKTLAPYAKFNKLFSKNVEELTELQLTAVRTYSELGLSQLKAVGEVKDMQSLAEFNGQQLETLTKLSQQL 83  Photobacterium ...
WP_000287820  84 MDDSKKLQNIAKEFKDDVEKLASENLKTVT 113 Vibrio
WP_011706254  84 LDDIQKLNTLGQQFKDDLDALAADGIKKST 113 Aeromonas hydrophila
WP_011220435  84 MEDSKKFSSVAQTFKTEVEELVAENVKEVT 113 Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap