Conserved Protein Domain Family
short_TIGR02808

?
TIGR02808: short_TIGR02808 
TIGR02808 family protein
This very small protein (about 46 amino acids) consists largely of a single predicted membrane-spanning region. It is found in Photobacterium profundum SS9 and in three species of Vibrio, always near periplasmic nitrate reductase genes, but far from the periplasmic nitrate reductase genes in Aeromonas hydrophila ATCC7966. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131855
View PSSM: TIGR02808
Aligned: 3 rows
Threshold Bit Score: 58.3315
Threshold Setting Gi: 446027624
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
vfiat:VF1902  1 MSTLESVIWHTLGYAAMPAIILGGFAAVSVFSIWLLSLKSDK 42  Vibrio fischeri ES114
WP_005301193  1 MSLLEQTIWTVLGYGAMPFIFLSGFVAVAVTCCLLLNAFGVK 42  Aeromonas
WP_000105479  1 MSTLESIFWHVLGYSAMPVIILAGFLGVAVVSIGLLAMTKDK 42  Vibrio
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap