Conserved Protein Domain Family
clostrip

?
TIGR02806: clostrip 
clostripain
Clostripain is a cysteine protease characterized from Clostridium histolyticum, and also known from Clostridium perfringens. It is a heterodimer processed from a single precursor polypeptide, specific for Arg-|-Xaa peptide bonds. The older term alpha-clostripain refers to the most active, most reduced form, rather than to the product of one of several different genes. Clostripain belongs to the peptidase family C11, or clostripain family (see pfam03415). [Protein fate, Degradation of proteins, peptides, and glycopeptides, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131853
View PSSM: TIGR02806
Aligned: 2 rows
Threshold Bit Score: 939.462
Threshold Setting Gi: 399264
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P09870    55 KVTIMYYCDADNNLEGSLLNDIEEMKTGYKDSPNLNLIALVDRSPRYSSDEKVLGEDFSDTRLYKIEHNKANRLDGKNEF 134 Clostridium histoly...
BAB80552  54 KLTVMVYADCDNNLEEYILNDIEEMKEGYKNNPNLNIIVLVDRIPGYSNDSKVLGSNFEDTRLYKIGENSAERISGKSEF 133 Clostridium perfrin...
P09870   135 PEISTTSKYEANMGDPEVLKKFIDYCKSNYEADKYVLIMANHGGGAREKSN--PRLNRAICWDDSNLDkngeaDCLYMGE 212 Clostridium histoly...
BAB80552 134 PEITTTSNYEANMGDANTLKKFIKFCKKNYEADKYMLIMSNHGGGAKDDKDraSTVNKAICWDDSNNK-----DCLYTGE 208 Clostridium perfrin...
P09870   213 ISDHLTEKQSVDLLAFDACLMGTAEVAYQYRPGNGGFSADTLVASSPVVWGPGFKYDKIFDRIKAGGGTNNEDDLTLGGK 292 Clostridium histoly...
BAB80552 209 ISDVLTKDESVDVLVFDACLMGNSEVAYQYRPNNGSFEAKTLVASAPVVWGFGYPYDKIFSRLRSTKGDNGEVDSTLGGK 288 Clostridium perfrin...
P09870   293 EQNFDPATITNEQLGALFVEEQRDSTHANGRYDQHLSFYDLKKAESVKRAIDNLAVNLSNENKKSEIEKLRGSGIHTDLM 372 Clostridium histoly...
BAB80552 289 EKIFDPSTVTNNELGALFVEEQRDSVNSCRVTDQQLSCYDLSKIEKVKKSVDALARNLSKNNKKDAIEKLRGTGKNAPTM 368 Clostridium perfrin...
P09870   373 HYFDEYSEGEWVEYPYFDVYDLCEKINKSENFSSKTKDLASNAMNKLNEMIVYSFGDPSNN-FKEGKNGLSIFLPNGDKK 451 Clostridium histoly...
BAB80552 369 HYFKNYDEYEWIEYPYFDLYDLCEKISLSDEFNETTKKLSKNVMKNVDQLILYSFAGKDFKgFKEGKNGISIFLPDGNRN 448 Clostridium perfrin...
P09870   452 YSTYYTSTKIPHWTMQSWYNSIDTVKYGLNP-YGKLSWCKDGQDPEINKVGNWFELLDSWFDKTNDVTGGVNHYQW 526 Clostridium histolyticum
BAB80552 449 YYDQYSGQAIPHWAIQRWYNPLDTNAYRLRSgYGKLAWCKDGLDPKINKVGNWFELLDSWFDKDNTSLGGYNRYRY 524 Clostridium perfringens...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap