Conserved Protein Domain Family
exbB2

?
TIGR02805: exbB2 
tonB-system energizer ExbB, group 2
Members of this protein family appear to be the ExbB protein of an ExbBD proton-transporting membrane complex that, by means of TonB, energizes transport by TonB-dependent receptors. Note that this family represents one of at least two distinct groups TolQ homologs designated ExbB - see also TIGR02797. Each group associates with a distinct group of ExbD proteins, and a single species may have two ExbB/ExbD/TonB systems. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131852
View PSSM: TIGR02805
Aligned: 3 rows
Threshold Bit Score: 195
Threshold Setting Gi: 1169576
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43008         6 DFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAHYSTIHALDIDLNRNMTVISTIGANAPYVGLLGTVIGILLT 85  Haemophilus inf...
tigr:CJE1800   2 EFLKDYIDLIIFLILGIMAFIAFWCVVERMLFFRKINFKNYENQEQFDDAISENLTTIYIIYSNAPYIGLLGTVIGIMVT 81  Campylobacter j...
CAE10490       2 HLIKAYMDHAIFGILGFMSLLALAYAIERFLYYKNIKVDRYKDVNQLENDLTQNLTILSIIGSNAPYIGLLGTVIGIMVT 81  Wolinella succi...
P43008        86 FYQIGHGGGdIDPSVIMLHLSLALKATALGILVAIPSMVFYNGLGRKVEVNRLKWKVLS 144 Haemophilus influenzae Rd KW20
tigr:CJE1800  82 FYEMGLAGN-IDVKSIVVGLSLALKATALGLLVAIPALMAYNALLRRVSLLSNAYKANK 139 Campylobacter jejuni RM1221
CAE10490      82 FYDMGSGAG-IDTNAVLIGLSLALKATALGLLVAIPTLIVYTACLRKVDVHIAAWKSLD 139 Wolinella succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap