Conserved Protein Domain Family
ExbD_2

?
TIGR02804: ExbD_2 
TonB system transport protein ExbD, group 2
Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Statistics
?
PSSM-Id: 131851
View PSSM: TIGR02804
Aligned: 3 rows
Threshold Bit Score: 165.821
Threshold Setting Gi: 57167445
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:CJE1801  14 NEGLNIVPFIDIMLVLLAIVLSISTFIAHGKIQISLPSSENATNISnNEKKLLITIDEKNTFYLNDKLADLNEVQNAIFS 93  Campylobacter j...
CAE10489       6 PEGLNIVPFIDVMLVLLAIVLTISTFIAQGKIKVDLPEASSAETKP-FDRKLEIVINADNELFVDETKVTLDELRAKLAP 84  Wolinella succi...
P43009         4 FDEINIIPFIDIMLVLLTVVLITASFISQGKIQVNVPKASTAVAFKsDELAKLLTVTADKQLYFNDKPISQEALEAEIAQ 83  Haemophilus inf...
tigr:CJE1801  94 LDKKTIVELKSDKNAKFESFVKIIDFLKAKEHENFQILTEK 134 Campylobacter jejuni RM1221
CAE10489      85 LTKDFPVVLKSDKESKFDIFIQVVDILKAKGHENLQIVAKQ 125 Wolinella succinogenes
P43009        84 WNKDQKVTLKIDAEASFQDFVTITDMLSKNEIKNVAIVSMK 124 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap