Conserved Protein Domain Family
ExbD_1

?
TIGR02803: ExbD_1 
TonB system transport protein ExbD, group 1
Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Statistics
?
PSSM-Id: 131850
View PSSM: TIGR02803
Aligned: 4 rows
Threshold Bit Score: 181.183
Threshold Setting Gi: 23348524
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK70857     15 NHEINVTPFIDVMLVLLIIFMVAAPLATVDIKVDLPASTAKPAPRPEKPVFVSVKADQKLYVGDDQVAApDQLGPMLDAK 94  Pseudomonas puti...
CAE27569     18 AHEINVTPFIDVMLVLLIVFMVAAPLATVDVGVDLPASTAAPQPRPEKPIFVSLKPDLSLALGEEMVPR-EALTSALDSV 96  Rhodopseudomonas...
tigr:BR1667  16 NHEINVTPFIDVMLVLLIIFMVAAPLATVDVKVDLPASAAAPAPRPDKPLYVTLKEDLSVSVGNDTVAR-ERLGAALDGL 94  Brucella suis 1330
P0ABV5       15 MHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTD-ETMITALNAL 93  Shigella flexneri
AAK70857     95 TKGDKETTIFFQADKGVDYGDLMEVMNNMRAAGYLKVGLVGLE 137 Pseudomonas putida DOT-T1E
CAE27569     97 TGGNKDERIFLRADKAVSYGDLMAAMNLLRDAGYLKVALVGLD 139 Rhodopseudomonas palustris CGA009
tigr:BR1667  95 SEKDKETRIFLRADKNVAYGELMRVMNLLREAGYLKIALVGLE 137 Brucella suis 1330
P0ABV5       94 TEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEE 136 Shigella flexneri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap