Conserved Protein Domain Family
ligK_PcmE

?
TIGR02798: ligK_PcmE 
4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase
Members of this protein family 4-carboxy-4-hydroxy-2-oxoadipate aldolase, also called 4-oxalocitramalate aldolase. This enzyme of the protocatechuate 4,5-cleavage pathway converts its substrate to pyruvate plus oxaloacetate. Protocatechuate is an intermediate in many pathways for degrading aromatic compounds, including lignin, fluorene, etc. Hara, et al. showed the LigK gene was not only a 4-carboxy-4-hydroxy-2-oxoadipate aldolase but also the enzyme of the following step, oxaloacetate decarboxylase.
Statistics
?
PSSM-Id: 131845
View PSSM: TIGR02798
Aligned: 5 rows
Threshold Bit Score: 341.439
Threshold Setting Gi: 13242045
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB87566   3 GIVVQNIERASLSVVDGLAKCGVATVHEAQGRTGLLAPTMRPIYTGARIAGSAVTISAPPGDNWMVHVAIEQLKEGDVLL 82  Sphingomonas sp. LB126
BAB88738   7 GVVVQNIERAPLEVIDGLAACGVATVHEAQGRTGLLASYMRPIYRGARVAGSALTISAPPGDNWMVHVAIEQLKAGDILL 86  Sphingomonas paucim...
AAK73570   5 GVVYRNIQRADRAAADGLAALGSATVHEAMGRVGLLKPYMRPIYAGKQVSGTAVTVLLQPGDNWMMHVAAEQIQPGDIVV 84  Comamonas testosteroni
CAE30138   9 GIVKRNITRANKAAVEKLSRFGVATVHEAMGRVGLMQPYMRPIYQGAHICGTAVTVLLQPGDNWMMHVVAEQIQPGDVVV 88  Rhodopseudomonas pa...
AAK16525   7 GIVRTNIERPDPADVKRLSQFGVATIHEAMGRVGLLRPYIRPAYTGAKLCGPAVTVLLQPGDNWMFHVAAEQVQEGDVIV 86  Arthrobacter keyseri
CAB87566  83 LAPTSPCTDGYFGDLLATSAQARGCRGLIIDAGVRDVRDLKQMNFPVWSKAIHAQGTIKATLGSVNIPVVCANALVNPGD 162 Sphingomonas sp. LB126
BAB88738  87 LAPTSPCEDGYFGDLLATSAQARGCRGLVIDAGVRDVRDLTEMNFPVWSKAIYAQGTVKNTLGSVNVPVVCANALVNPGD 166 Sphingomonas paucim...
AAK73570  85 AAVTAECSDGYFGDLLATSFQARGARALIIDAGVRDVKTLQEMDFPVWSKAISSKGTIKATLGSVNIPIVCAGMLVTPGD 164 Comamonas testosteroni
CAE30138  89 AACTADSTDGFFGDLLATSFRARGALGLIIDAGVRDVRDLTQMNFPVWSKAIHAKGTVKATLGSVNIPVVAAGAHITPGD 168 Rhodopseudomonas pa...
AAK16525  87 AGCTTESEDGFFGELLATSLTARGCKGLVIDGGVRDVADLEKMDFPVFSRAVNAKGTVKATLGSVNIPVVVANAVVNPGD 166 Arthrobacter keyseri
CAB87566 163 VVIADDDGVCVVPRANAAAVLEKAQAREAAEEAKRVRLASGELGLDIYNMRPRLEEMGLKYV 224 Sphingomonas sp. LB126
BAB88738 167 VIVADDDGVCVVPLANAEKVLEAARAREANEGDKREKMANGVLGLDLYKMRERLEKEGLKYV 228 Sphingomonas paucimobilis
AAK73570 165 VIVADDDGVVCVPAARAVEVLAAAQKRESFEGEKRAKLASGVLGLDMYKMREPLEKAGLKYI 226 Comamonas testosteroni
CAE30138 169 VVIADDDGVVVVPAAVAQMAADAAEAREANEADKRAKLASGVLGLDMYKMREPLEKAGLKYI 230 Rhodopseudomonas palustris CGA009
AAK16525 167 VVVADVDGVVVVPRELVGAVADASQKREDNEEAKRVKFREGVLGLDVYGMRGPLAKAGLEYV 228 Arthrobacter keyseri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap