Conserved Protein Domain Family
exbB

?
TIGR02797: exbB 
tonB-system energizer ExbB
This model describes ExbB proteins, part of the MotA/TolQ/ExbB protein family. The paired proteins MotA and MotB, TolQ and TolR, and ExbB and ExbD harness the proton-motive force to drive the flagellar motor, energize the Tol-Pal system, or energize TonB, respectively. Tol-Pal and TonB are both active at the outer membrane. Genomes may have many different TonB-dependent receptors, of which many of those characterized are involved in siderophore transport across the outer membrane. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131844
View PSSM: TIGR02797
Aligned: 10 rows
Threshold Bit Score: 323.197
Threshold Setting Gi: 27355354
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE28719          78 SPIGMFIAADWVVKAVMIALLLASFLSWTICVAKAVEVACANARAKRAFLIVDRSRDLDEAVHRLSKRG--GPAVFMVRS 155 Rhodopseudo...
CAC46090          87 SPVGMFLAADIVVKAVMVALALASVATWAIFLVKTLELIYAKSRLKRAVAALVSANGLAEVQSKLERRA--GVAGEMVAA 164 Sinorhizobi...
AAL41185          83 SPWGMFMAADWVVKGVMIGLAFASLVTWTVWVAKSIELAGARVRAGSTLKVIRRAKTLAEATDAVENKG--GPAALMLRM 160 Agrobacteri...
AAK08069          89 SPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSATLNDAVHALDGAK--GPGAAFVRA 166 Brucella me...
BAB50884          21 SPWGMFIAADIIVKAVMIGLAFASLVTWTIWLAKSLEILGGKLRIRRAVRAIGDAATLKQASRALGRSG--GPGALLVKA 98  Mesorhizobi...
P0ABU7            11 SVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSLNQANDIAADFGskSLSLHLLNE 90  Escherichia...
Q05605           102 SPWGMYKNADIVVKIVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQLKKSASLKEASEVSNKEG--TLAHTLVHD 179 Pseudomonas...
CAE28919           9 SPWTMFLNADIIVKIVMIGLAISSVITWTIFIAKKVELGRARFRLRRSLKEIGESRSLAEAQMALGDKH--SVLSMLLAA 86  Rhodopseudo...
BAC52338          39 SPWGMFLGADIIVKTVMIGLAVASVVTWTVWLAKTVELRRKSALAVQRTRALEGRMKLAEAAERTGDAH--DAVAQLIQS 116 Bradyrhizob...
goetting:GOX0532   6 SPWQMFLDAGPVVRGVMTILAMASLVTWTIFIAKTIELQRLRSRLKKSEITLEDAETLDIGEEWTRTGSgsGIAHAMVMA 85  Gluconobact...
CAE28719         156 ASEELHRSLPvlAYSGEAGLKERVVSRLARIEAQAGRRLMRGTGLLATVGAVSPFVGLFGTVWGIMNAFIGISQSHTTNL 235 Rhodopseudo...
CAC46090         165 AIDEMTRSEAvlDLAPAVGVKERVSSLLTRIEVRAGKRMSAGTGILASIGSVGPFVGLFGTVWGIMNSFIGISKAQTTNL 244 Sinorhizobi...
AAL41185         161 ATHEMQLSDAvvEHTDGGGIKERVSSALSRIETHAGRRMSRGTGALATIGSTAPFVGLFGTVWGIMNSFISISESQTTNL 240 Agrobacteri...
AAK08069         167 AEDEVRLSGPalARAGGEGLKERVASRLSRIEAKAGRRLAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNL 246 Brucella me...
BAB50884          99 AEEETALSAGalDHVGGDGLKERVTSRLSRIEAAASRRMSRGTGVLATIGSTAPFVGLFGTVWGIMNAFIGISQAQTTNL 178 Mesorhizobi...
P0ABU7            91 AQNELELSE---GSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNL 167 Escherichia...
Q05605           180 ALEEMRLSA---NTREKEGIKERVAFRLERLVAASGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNL 256 Pseudomonas...
CAE28919          87 ALREAKLSA---GLSSDEGIKERAASSFSEYVRAEGRHMRRGMGFLATIGATAPFIGLFGTVWGIMNSFIGISKSQTTNL 163 Rhodopseudo...
BAC52338         117 CAKEAELSG----GIVDDGLQERVALRLERVEAAMSRQIARGTGVLATIGATAPFVGLFGTVWGIMNAFIGISESHTTSL 192 Bradyrhizob...
goetting:GOX0532  86 AEVERQRSQD--IPGDREGIKERIVLHLERLEAAEGRRLMRGTGVLATIGATSPFVGLFGTVWGIMSSFTGIAAAHATSL 163 Gluconobact...
CAE28719         236 AVVAPGIAEALLATAFGLVAAIPAVIIYNVFARAISGYRQVLADAAAGVERLISL 290 Rhodopseudomonas palustris CGA009
CAC46090         245 AIVAPGIAEALLATAIGLVAAIPAVVIYNYFARSVGGYKLILADAAAAVERLVSR 299 Sinorhizobium meliloti 1021
AAL41185         241 AVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSITGYRHLLADAAAGVERLVSR 295 Agrobacterium tumefaciens str. C58
AAK08069         247 AVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSITGYRALLADASAGVERLVSR 301 Brucella melitensis
BAB50884         179 AVVAPGIAEALLATAMGLVAAIPAVVIYNVFARSIAGYRQILADASAGVERLVSR 233 Mesorhizobium loti MAFF303099
P0ABU7           168 AVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSR 222 Escherichia coli K-12
Q05605           257 AVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSR 311 Pseudomonas putida
CAE28919         164 AVVAPGIAEALLATAIGLVAAIPAVIIYNHFSREIKLYLELVARASGAAGRLLSR 218 Rhodopseudomonas palustris CGA009
BAC52338         193 AVVAPGIAEALLATALGLVAAIPAVVIYNHLVRGIANYRALLGDASAQLMLLVSR 247 Bradyrhizobium diazoefficiens USDA 110
goetting:GOX0532 164 AVVAPGIAEALLATALGLVAAIPAVVIYNHLARQTAACRACLADLTSLVMRLVSR 218 Gluconobacter oxydans 621H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap