Conserved Protein Domain Family
tolQ

?
TIGR02796: tolQ 
TolQ protein
TolQ is one of the essential components of the Tol-Pal system. Together with TolR, it harnesses protonmotive force to energize TolA, which spans the periplasm to reach the complex of TolB and Pal at the outer member. The tol-pal system proves to be important for maintaining outer membrane integrity. Gene pairs similar to the TolQ and TolR gene pair often number several per genome, but this model describes specificially TolQ per se, as found in tol-pal operons. A close homolog, excluded from this model, is ExbB of the ExbB/ExbD/TonB protein complex, which powers transport of siderophores and vitamin B12 across the bacterial outer membrane. The Tol-Pal system is exploited by colicin and filamentous phage DNA to enter the cell. It is also implicated in pathogenesis in several bacterial species [Transport and binding proteins, Other, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131843
View PSSM: TIGR02796
Aligned: 22 rows
Threshold Bit Score: 254.865
Threshold Setting Gi: 21646569
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN55779                  6 SFIGLFLQASLLVKFVMFTLLGLSIMSWTVILQRRSLLTGAKNKSAKFEDKFWSGVDLNRLYKELSARPdNT-G-LESLF 83  Shew...
jgi:Daro_4056             8 SILHLILQASAVVQAVMALLAGVSFMSWYYIFMKLFSVKQARSKTETFERDFWSGGDLNNLYNSAVNDRhHA-GsMERIF 86  Dech...
CAG69377                 10 HISDLILQASPVVQAVMLILLLASIYSWYLIAKLHLSYKKSAQQDEHFQKMFWSGAELNTLYNNAQLNSkRT-G-LEDIF 87  Acin...
chgcsh:XC1138            38 NYAELILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLAKLYASATDRNrTV-GgLESMF 116 Xant...
goetting:GOX1684         19 SPLDLFLHASIVVKLVMLGLLLCSAGVWAIIAEKIILIRRVNREATEFEDRFWSGGSLDDLYESDGAR--PT-HpMAAVF 95  Gluc...
gnl:microosu:SAR11_0594  19 SLWSLFLRADFIVKSVILMLIGCSIYSWAVIIEKFRLFKKINLESEEFEEKFWKSKSAESFYNSLPAD--VE-NpTALLF 95  Cand...
AAK25195                 11 SFFALFMQADWVVKSVMIGLILASLGSWAVILDKLFRFQALNRAANRFEEQVSGGRSLEDVAGEAGAN--PR-HaLPRML 87  Caul...
WP_011712166              5 SVFDLITQAGPLVQLVMLALLAASVVSWAIIFDKWRRYRRITQDAEAFEERFWSGGSVASLFQSATKEW-PD-SpMVVMF 82  Magn...
WP_012535768             14 SLGHLVMNASWVVQGILAILMIASVISWTIIFQKWAIFAAAQRALERFEKRFWSGGEMSQIYQHVSGNA-NLeTgAGSIF 92  Acid...
WP_002720852             15 SMLALFARATLTVKFVMILLIVMSFWSWAIIVRKHLLYRQARREAAIFDRAFWSGEPLDELFERLGPQ--PE-GaSEKIF 91  Rhod...
AAN55779                 84 VTGFKEYSRLNKLN---SKVPDAVMDGTSRAMRVTLSRELEKLEANLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGS-M 159 Shew...
jgi:Daro_4056            87 EAGFREFTKLKGQK---NLDPKDIVDGSRRAMRATYQREMDALESHLSFLASVGSVSPYIGLFGTVWGIMHAFRGLSN-V 162 Dech...
CAG69377                 88 YHGLGEFFKLKKR----QATSTQTIEGTERILRVGLSRDQSQLEQGLGTLASIGSVAPYVGLFGTVWGIMNAFIGLAA-V 162 Acin...
chgcsh:XC1138           117 ESGFREFSRLRDRR---RLDARVQLEGAQRAMRTAFTREVDQLERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSsG 193 Xant...
goetting:GOX1684         96 GAAMGEWRRSARIGgidL-SRGGVRERVDRAIDITIMRENDRLTRRLIFLATIGPVAPFVGLFGTVWGIMHSFASIAQmH 174 Gluc...
gnl:microosu:SAR11_0594  96 KDTMQSLLKAKSKTn--------LNERIASILEVNIEKQISKIDKGFTFLATVGSTAPFIGLFGTVWGIMNSFQSIAIsR 167 Cand...
AAK25195                 88 QAALKEWRDAKSKGamsETQAGFLIARIDRILDTQIARETTKVEEGLGSLAIVATASPFIGLFGTVWGIMHAFQNIALsK 167 Caul...
WP_011712166             83 SAGFREWKRWESNEptsEGDGGDLVTNVRRAMTVALNRELENLEKGLTFLATVGSTSPFVGLFGTVWGIMNAFLGLTG-A 161 Magn...
WP_012535768             93 CAGYEEFQRQRNK-----IRPSDALDAARRAMRVAQMREVGRLENNLAFLASVSSVSPFIGLFGTVWGIMTAFMNIGm-A 166 Acid...
WP_002720852             92 AAGMLEWRRSHRND---GGLIAGAQSRIDRSMGVAIDKESETLNSGLSFLATTGSTAPFIGLFGTVWGIKHAFEQIAIsQ 168 Rhod...
AAN55779                160 ENATLAMVAPGIAEALIATAMGLFAAIPAVIAYNRFATQVEKLEIAYANFMEEFSSILHR 219 Shewanella oneidensis MR-1
jgi:Daro_4056           163 GQATLASVAPGIAEALVATAIGLFAAIPAVLAYNRFSHDIDRLATRYESFMEEFSNILQR 222 Dechloromonas aromatica RCB
CAG69377                163 DQVTLATVAPGIAEALIATAIGLFAAIPAVLAFNHFTSKGEAIYSDRALFAEEMVALLQR 222 Acinetobacter sp. ADP1
chgcsh:XC1138           194 EQAGIAAVAPGISEALFATAIGLFVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQR 253 Xanthomonas campestris p...
goetting:GOX1684        175 N-TNLSVVAPGISEALFATAIGLVTAIPAYIAYNGLSNSFEKFADRMEAFGTEFAAILSR 233 Gluconobacter oxydans 621H
gnl:microosu:SAR11_0594 168 N-TSLAIVAPGIAEALFATALGLLAAIPAVVAYNKFNNDSKKYSQRLENFSKRFLSII-- 224 Candidatus Pelagibacter ...
AAK25195                168 N-TSLAVVAPSIAEALFATAIGLIAAIPAYIAYNKFSTDAGKYAGRLEGFADDLSTAIQR 226 Caulobacter crescentus CB15
WP_011712166            162 KASTLTMVAPGIAEALIATAMGLVAAIPSVIAYNKYSSEMRRLHAKMDNFGAEFLNILER 221 Magnetococcus marinus
WP_012535768            167 GQATLATVAPPVAEALIATAAGLFAAIPATAAYNRYIHQLDKLDAQYEVFMDEFTNILHR 226 Acidithiobacillus ferroo...
WP_002720852            169 N-TNLAVVAPGIAEALLATAFGLVAAIPAVVFYNKLNADSERIIGGYDAFSDEFATILSR 227 Rhodobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap