1Q5V


Conserved Protein Domain Family
nikR

?
TIGR02793: nikR 
Click on image for an interactive view with Cn3D
nickel-responsive transcriptional regulator NikR
Three members of the seed for this model, from Escherichia coli, Pseudomonas putida, and Brucella melitensis, are found associated with a nickel ABC transporter operon that acts to import nickel for use as a cofactor in urease or hydrogenase. These proteins, with characterized nickel-binding and DNA-binding domains, act as nickel-responsive transcriptional regulators. In the larger family of full-length homologs, most others both lack proximity to the nickel ABC transporter operon and form a separate clade. Several of the homologs not within the scope of this model, but rather scoring between the trusted and noise cutoffs, have been shown to bind nickel, copper, or both, and to regulate genes in response to nickel. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131840
View PSSM: TIGR02793
Aligned: 5 rows
Threshold Bit Score: 176.567
Threshold Setting Gi: 37927840
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q5V_A   2 QRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHG-TQGFAVLSYVYEHEKRDLASRIVSTQHHHHD 80  Escherichia coli BW2952
Q6N0K6   2 HRVTITLDDDLMEKLDAIIAARGYQNRSEAIRDLARIGIQQTAAETTS-GHCVGAMVYTYDHSKRDLPRKLTQSFHHHHD 80  Rhodopseudomonas palu...
P0A6Z9   2 QRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHG-TQGFAVLSYVYEHEKRDLASRIVSTQHHHHD 80  Shigella flexneri
Q88HL5   2 QRITITLDEELLDVIDRRVATQGYQGRSEAIRDLLRAGMRESEALPDD-AACVAVVSYLYDHSTRELPRRLNQTLHAHHD 80  Pseudomonas putida KT...
Q9AL83   2 QRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQQASLEEGQmEACVGVLSYTYDHSARDLSKKLTNTHHDHHN 81  Brucella suis 1330
1Q5V_A  81 LSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLP 130 Escherichia coli BW2952
Q6N0K6  81 LSRATMHVHLDHDQCLEVTILDGNATELQHFADHIFAERGVRYGRLVTIP 130 Rhodopseudomonas palustris CGA009
P0A6Z9  81 LSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLP 130 Shigella flexneri
Q88HL5  81 LTRSTLHVHLDAGHCLEVSVLQGESGRIGELSRQLMVERGVEHGQVQVIP 130 Pseudomonas putida KT2440
Q9AL83  82 ISVASMHVHLDHDRCLEVSILKGKTDDVRHFADHVKAERHVTHGTLAVLP 131 Brucella suis 1330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap