1BOU


Conserved Protein Domain Family
PCA_ligA

?
TIGR02792: PCA_ligA 
Click on image for an interactive view with Cn3D
protocatechuate 4,5-dioxygenase, alpha subunit
Protocatechuate (PCA) 4,5-dioxygenase is the first enzyme in the PCA 4,5-cleavage pathway that is an alternative to PCA 3,4-cleavage and PCA 2,3 cleavage pathways. PCA is an intermediate in the breakdown of lignin (hence the gene symbol ligA) and other compounds. Members of this family are the alpha chain of PCA 4,5-dioxygenase, or the equivalent domain of a fusion protein. [Energy metabolism, Aerobic]
Statistics
?
PSSM-Id: 131839
View PSSM: TIGR02792
Aligned: 4 rows
Threshold Bit Score: 222.892
Threshold Setting Gi: 4929923
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BOU_A    17 FDDIPGTRVFTAQRARKGYNLNQFAMSLMKAENRERFKADESAYLDEWNLTPAAKAAVLARDYNAMIDEGGNVYFLSKLF 96  Sphingomonas paucim...
AAW66636   7 YLDVPGTIIFDAEQSRKGYWLNQFCMSLMKAENRDRFRANERAYLDEWAMTEEQKQAVLARDLNWCMRTGGNIYFLAKIG 86  Comamonas sp. DJ-12
P22635    17 FDDIPGTRVFTAQRARKGYNLNQFAMSLMKAENRERFKADESAYLDEWNLTPAAKAAVLARDYNAMIDEGGNVYFLSKLF 96  Sphingomonas paucim...
AAK16524   7 YKDVPGTTIFDADQARKGYNLNQFCMSLMKPENRERYLADRGAYLDEWPLNPVQRQAVLDIDLNTCIAEGGNIYFLAKIG 86  Arthrobacter keyseri
1BOU_A    97 STDGKSFQFAAGSMTGMTQEEYAQMMIDGGRSPAGVR 133 Sphingomonas paucimobilis
AAW66636  87 ATDGKSFQQMAGSMTGMTEDEYRAMMMGGGRSAEGNR 123 Comamonas sp. DJ-12
P22635    97 STDGKSFQFAAGSMTGMTQEEYAQMMIDGGRSPAGVR 133 Sphingomonas paucimobilis
AAK16524  87 ATHGLSFQQMAGSMTGMSEAAYRDMMIGGGRRPEGNR 123 Arthrobacter keyseri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap