Conserved Protein Domain Family
nickel_nikC

?
TIGR02790: nickel_nikC 
nickel ABC transporter, permease subunit NikC
This family consists of the NikC family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikB. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131837
View PSSM: TIGR02790
Aligned: 6 rows
Threshold Bit Score: 362.858
Threshold Setting Gi: 462712
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM06831  32 AVSGILLIAVLCVLALFAPKLAPHDPLAQRLDSRLLSPSLEYPFGTDELGRCIFSRVIYGTRISLGIGLLVVAVTSIAGT 111 Methanosarcina acet...
BAB04288  15 VVVCSVILFVFFLLAILAPWIAPHDPIQVNLALKLLPPSWEYPLGTDQLGRCNLSRLLFGARVSLGFATLIFISSLGIGL 94  Bacillus halodurans...
CAE10089  11 GAMALAILLVVFIMGIFASFFALHDPLEQNILMKFAGVSMEYPFGTDHLGRCIYSRMVFGIQNTVFLALLTMVCAIVIGV 90  Wolinella succinogenes
AAM06825  31 AVFGLLIVALIIFVAIAASVIAPNDPLKVNMSMRFKGPSSLYWLGTDNLGRCIASRLIWGARMSLIYSLCVLGLMMAIST 110 Methanosarcina acet...
P33592    11 VRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLGRDIFSRLMAATRVSLGSVMACLLLVLTLGL 90  Escherichia coli
AAK69196  11 GKSAFVGVGIIVFLALFAPFLTSYAPDMQDLEHRLSPISMHHWLGTDYLGRDIFSRLLYGARLSLGCAFIILGWIVLLGV 90  Helicobacter hepaticus
AAM06831 112 SLGLLSGYRGGVLDEAIMRGVDIVMAFPNIILALVIAGLMGPGFSSVVFALVFTQWPAYARLVRGQVLSLRKRAFVEAAR 191 Methanosarcina acet...
BAB04288  95 LVGAIAGYRGGWIDSVLMRFCEGVMAFPNLVLVLGLVGLFGPGLWQVVLALVMVQWVYYARMFRSMIVSLKEQNFITAAR 174 Bacillus halodurans...
CAE10089  91 LVGIVAGYYGGVVDEVIMRFCDVMLSFPSQVMILAIVGIMGVGIENIIIANILIKWTWYARMIRGIVVSYAHKNYVLYAK 170 Wolinella succinogenes
AAM06825 111 PIGLLSGYAGGRMDTFIMRVTDIFLSLPTFLMALAIAGMLGPSVKNMIIAMASVWWAPYARIIRGMAMQIKQQDFMLAAK 190 Methanosarcina acet...
P33592    91 VIGGSAGLIGGRVDQATMRVADMFMTFPTSILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASR 170 Escherichia coli
AAK69196  91 SIGGICGFIGGRVDNIFMRVCDVFLSMPTIALSLFLVGILGAGLENVMIAIVLTHWAWYARIVRSVVFSLKNKEYVLLSY 170 Helicobacter hepaticus
AAM06831 192 ALRPSSFYIMRKHILPNCMEPVIVLGTLEIAHVIIFASALSFLGLGIQPPVPEWGSMLKAGIPYLRTAPHLTFFPGLMII 271 Methanosarcina acet...
BAB04288 175 ISGSSPWKIIRRHIIPNVLPPIVVIGTLEMGWAIMDISALSFLGLGIQPPTPEWGAMIHEGKSFIRSHPELMLYPGIMIL 254 Bacillus halodurans...
CAE10089 171 TIGKSDSFIISRHLVPSITSEIIILGTLDIGWVIINISTLSFLGLGIQPPFPEWGAMLGEAKNTLITQPAQMIAPGMAIL 250 Wolinella succinogenes
AAM06825 191 AAACTHCQIIFRHILRNIASPIIVMATLEIGSIILAIASFSFIGLGAQPPTPEWGIMLSDSKEFMQTQPQLMIYPGIAIL 270 Methanosarcina acet...
P33592   171 LSGAGHVRVFVDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPLQMFWPGLALF 250 Escherichia coli
AAK69196 171 TFGASGWQRFKRHILSPILCQCIVLASMDLGHIMLHIAGLSFLGLGVQPPTPEWGIMLSEAKDYMWDYPSLIIYPGVALF 250 Helicobacter hepaticus
AAM06831 272 FTVFAFNFAGDGLRDNLG 289 Methanosarcina acetivorans C2A
BAB04288 255 LVVMTFNVLGESLSGRFG 272 Bacillus halodurans C-125
CAE10089 251 TVVACFNILGDSLRDILD 268 Wolinella succinogenes
AAM06825 271 FTVMAFNLLGEGLKNAIQ 288 Methanosarcina acetivorans C2A
P33592   251 ISVMAFNLVGDALRDHLD 268 Escherichia coli
AAK69196 251 ISVGLCNLLGEALRDYFG 268 Helicobacter hepaticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap