Conserved Protein Domain Family
nickel_nikB

?
TIGR02789: nickel_nikB 
nickel ABC transporter, permease subunit NikB
This family consists of the NikB family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikC. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131836
View PSSM: TIGR02789
Aligned: 4 rows
Threshold Bit Score: 479.642
Threshold Setting Gi: 24984984
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P33591          1 MLRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGLDQPLYVQYGTWLWKALHLDF 80  Escherichia co...
AAN68947        1 MLRYILLRLALLVPVMLGASLLVFVLLHLGSTDPALDYLRLSHIPPTDAAIAEVRHTLGLDRPLYAQYLSWLWNAVHLDF 80  Pseudomonas pu...
novoz:BL02419   1 MGNYILKRIMSIIPVFLLAALLTTGMIHLSPVDPAEAYLAAAHIQPTDEILAQKRHEFGLDQPFFIQYVNSVLKICQLDF 80  Bacillus liche...
CAE10088        1 MRNYIIRRLLLVFPMVLAISFVAFILISFIPSDPAEVALRVNEIVPTPQAIADMRESLGLNDPLWVRYFHWLQNCLHLDF 80  Wolinella succ...
P33591         81 GISFAS-QRPVLDDMLNFLPATLELAGAALVLILLTSVPLGIWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFS 159 Escherichia co...
AAN68947       81 GISYIT-GRPVLDDLLYYLPATLQLGGLALACTLLLSIPLGLLAARWQGRWPDHAVRAVTFLGVSMPNFWLAFLLIALFS 159 Pseudomonas pu...
novoz:BL02419  81 GISYVS-NQPVWDEVAHRMPATVELALGSLLIAVLVSVPLGFLAGIKRNGAVDHISRFISFFGASIPTFWLGYMLVFFFS 159 Bacillus liche...
CAE10088       81 GHSYINiDRTVYDEIARSLPVTLKLAAFAFVIVVAVSFPLGILCAVYRDSLFDKSMRVFIFIFTAIPNYWLALLLMWGLA 160 Wolinella succ...
P33591        160 VYLQWLPAMGYGGWQHIILPAVSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVG 239 Escherichia co...
AAN68947      160 LWLGWLPPLGRGGAGHLVMPVLAIALMSMSINARLLRASLLDAGGQRHVTYARARGLPERHVWRDHILRNAWLPLVTATG 239 Pseudomonas pu...
novoz:BL02419 160 VQLDLFPVEGAGTWQHLVLPSMTLALPLIAMYTRLLRASVIENLQEPYVQFARIRGIAKLNIMAKHVLRMAISPMITGLG 239 Bacillus liche...
CAE10088      161 VYLNLLPTNGASTWKHYILPAVTLSMTYVSTYIRLIRNSMLDNMQENYIFYARVRGIKERWVILRHLLPNSIQSTTTALG 240 Wolinella succ...
P33591        240 MHIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNAALDPRIRrHEGAHA 314 Escherichia coli K-12
AAN68947      240 MHIGELLGGALVIETIFAWPGVGRFAVSAVLNRDFPVMQCFTLLLTGLLMICNLIVDVCYAWLDPRSR-LEGVNA 313 Pseudomonas putida ...
novoz:BL02419 240 MNLGKLLTGTIIVEVVFSWPGFGRYFIEAIFNRDIPVIQCYVFLAATFFILSNLIVDLIQMYIDPRISrKEGQHR 314 Bacillus lichenifor...
CAE10088      241 MSVVQLIAGTFVIENIFSLPGIGRLCITAIFNRDYPIIQAYILMMGLLFVFCNLLIDIFQALMDPRQRr--GVK- 312 Wolinella succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap