Conserved Protein Domain Family
codY_Gpos

?
TIGR02787: codY_Gpos 
GTP-sensing transcriptional pleiotropic repressor CodY
This model represents the full length of CodY, a pleiotropic repressor in Bacillus subtilis and other Firmicutes (low-GC Gram-positive bacteria) that responds to intracellular levels of GTP and branched chain amino acids. The C-terminal helix-turn-helix DNA-binding region is modeled by pfam08222 in Pfam. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131834
View PSSM: TIGR02787
Aligned: 6 rows
Threshold Bit Score: 378.304
Threshold Setting Gi: 51856311
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO81423       4 LLEKTRQVNELLQKNnlfdVQAELPYNKMAMILGDILESNAYIISSSGDLLGYTEKLDVNNAR-IKNMFKEKKFPQGYTE 82  Enterococcus fa...
CAB13490       3 LLQKTRIINSMLQAA----AGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDR-MKKMLEDRQFPEEYTK 77  Bacillus subtil...
Q8XJQ5         4 LLSKTRRLNKILQKS----GTEAIAFGDICQLLSDVMSCNVYLVGRKGRILGYSFSEKFECDImKEKVVVDRKFPEDYNN 79  Clostridium per...
BAD40469       4 LLEKTRRINRLLQKS----AGTQVNFNELAGVLADLIGADVYVASRKGNIVGLGLTAGDA------DAYQNITFTEEYNS 73  Symbiobacterium...
Q9CJ45         4 LLEKTRKITAILQDGvt-dLQQELPYNSMTERLANVIDCNACVINTKGELLGYSLPYNTNNDR-VDQFFYDRKLPDEYVR 81  Lactococcus lac...
WP_000940729   4 LLEKTRKITSILKRSee-qLQDELPYNAITRQLADIIHCNACIINSKGRLLGYFMRYKTNTDR-VEQFFQTKIFPDDYVQ 81  Streptococcus p...
AAO81423      83 AVDMLKVTEANIPIDSDLTAFPFESRELYPFGLTTIVPLYGAGKRLGTIILARVEKSFNEDDLVLAEYSATVVGMQILYH 162 Enterococcus fa...
CAB13490      78 NLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILRE 157 Bacillus subtil...
Q8XJQ5        80 KLINIQDTIANI-PNKGICVFEGVGECLISKKISTIVPIVGNGDRLGTLLLARFGEEFNDDDLVLAEYSATIVGMELLRA 158 Clostridium per...
BAD40469      74 SLMKVDDTTANT-EQSELTVLQEGREVQMRGGRVTIVPVNGGGERLGTLVLVKS-ADLTDEDLILGELAATVAGVEILRA 151 Symbiobacterium...
Q9CJ45        82 AAVRIYDTMANVPVDRPLAIFPEESLGDFPKGVTTLAPIYGSGMRLGTFIMWREDGEFTDDDLVLVELATTVIGVQLSNL 161 Lactococcus lac...
WP_000940729  82 GANMIYETEANLPVEHDMSIFPIESRDDFPDGLTTIAPIHVSGIRLGSLIIWRNDKKFEDEDLVLVEIASTVVGIQLLNF 161 Streptococcus p...
AAO81423     163 QSRTIEAEVRSATAVQMAINTLSYSELKAVHAIFEALDGEEGRLTASSIADEIGITRSVIVNALRKLESAGIIESRSLGM 242 Enterococcus fa...
CAB13490     158 KAEEIEEEARSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGM 237 Bacillus subtil...
Q8XJQ5       159 RQGEIEEEARKKAVVQLAIGTLSYSELEAVEHIFSELNGDEGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGM 238 Clostridium per...
BAD40469     152 HAGELEEEARKKAAVQIALATLSYSELEAVQHIFDELDGNEGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGM 231 Symbiobacterium...
Q9CJ45       162 KLEQMEENIRKDTMATMAVNTLSYSEMKAVKAIIEELDGEEGHVIASVIADKIGITRSVIVNALRKLESAGVIESRSLGM 241 Lactococcus lac...
WP_000940729 162 QREEDEKNIRRRTAVTMAVNTLSYSELRAVSAILGELNGNEGKLTASVIADRIGITRSVIVNALRKLESAGIIESRSLGM 241 Streptococcus p...
AAO81423     243 KGTYLKVLNQQFIKEL 258 Enterococcus faecalis V583
CAB13490     238 KGTYIKVLNNKFLIEL 253 Bacillus subtilis subsp. subtilis str. 168
Q8XJQ5       239 KGTHIKILNEKLMDEL 254 Clostridium perfringens str. 13
BAD40469     232 KGTHIKVLNDRLIEEL 247 Symbiobacterium thermophilum IAM 14863
Q9CJ45       242 KGTYLKVLNTGLFDKL 257 Lactococcus lactis subsp. lactis Il1403
WP_000940729 242 KGTYLKVLISDIFEEV 257 Streptococcus pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap