Conserved Protein Domain Family
TrbL_P

?
TIGR02783: TrbL_P 
P-type conjugative transfer protein TrbL
The TrbL protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbL is a homolog of the F-type TraG protein (which is believed to be a mating pair stabilization pore-forming protein, pfam07916) as well as the vir system VirB6 protein. [Cellular processes, Conjugation]
Statistics
?
PSSM-Id: 131830
View PSSM: TIGR02783
Aligned: 7 rows
Threshold Bit Score: 221.889
Threshold Setting Gi: 501634974
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG23463      18 AQNNNALDDLLGQFHTQTALWEPIILQSMWGLFWGLAVISLVWNAIQLVLHDKGIVDFIAFLFNRVMTIGLSVWLITNAS 97  Photobacterium ...
AAF84848      27 VDSVGLFDNILGRFHQVADTWSGEIVRYASWLFWSLALLSMVWTYGMMALRKADIQEFLAETIRFFAVMGFFWWLLINAP 106 Xylella fastidi...
tigr:BRA0366  29 AQSNTSMNSLLRLIQNASNQWAPRLHDYALWLLGCLAVIQLVWTFAPLVMRGAELGDLLHELVKYILVIGFFYAMLDHAT 108 Brucella suis 1330
AAC82634      29 AQQGTVLTTLENQVVTAAKGWETTILNAARSLFWILAGIEIGIAAVWLAINAASLDAWFAELVRRIMFIGLFAFILERGP 108 Agrobacterium f...
BAC53547       1 MNNVGVIDTFLNTFTTYIDSGFGLIKGEVTYLSSTLIVIDITLAGLFWAW--GADEDILQRLVKKTLYIGFFAFIITNFT 78  Bradyrhizobium ...
CAG37880     102 NSLINFIQQTVSIFATNAEIVGNRMEILALDIFQLLLLAEVIWLGLRMALKISDFKDTVIEFVKVLLVASLVLYIIKNHA 181 Desulfotalea ps...
WP_012607152  24 AAGSGSLSQVQSLLRGKILPWQSVMQTAATDLFYVLAAVEFSVLFLNHVLQKRGHEDLFAGIIKKVVTLGFFLTLLDNSG 103 Acidithiobacill...
CAG23463      98 ALAWAIINTFQKvAGLLSTNQEg----FSPSNVFELGLSIA-----HKVYSSAS--------GFS--------------- 145 Photobacterium ...
AAF84848     107 AMSTAIIDSLRQiAANATGLGNt----LSPSGIVDIGFDIT-----SKVIDDSS--------IRS--------------- 154 Xylella fastidi...
tigr:BRA0366 109 EWGGAIVNSFRQaGAHAAGLGSa---eLMPGDMFSTAVDFS-----RQVLTAGVs-------MFS--------------- 158 Brucella suis 1330
AAC82634     109 ALAKAVVDSLFQiGAGGGS--------ASPANIFDAGIRVA-----SKMSEQAKf------gLFE--------------- 154 Agrobacterium f...
BAC53547      79 KLSGIIFNSFAGlGLKAGGSSIstadfLRPGRLAQVGLDAG-----QPLLDSASqmmg-ftsFFS--------------- 137 Bradyrhizobium ...
CAG37880     182 EWINALSYGLTAsYDGSLASSTs----QSPETVVLNAIFIYi----EALLNKLH--------ITS--------------- 230 Desulfotalea ps...
WP_012607152 104 TWIPDIINGLAG-GAHALGVTA-----VTPGQIATEALQAFlgivlSPIAAATHnlgntfsdIFSgnfsaafssagkava 177 Acidithiobacill...
CAG23463     146 ---IGDNIVLGICALIILV---V-FAMIAAEMCILIVGAYVLVSSGVIVMAFLGSEWTRDHAMNYFTTVLGMAVQLFVMQ 218 Photobacterium ...
AAF84848     155 ---PVNSAVGIIASTVILI---V-LALIGVNMLLLLVSGWLLSYGAVFLLGFGGGRWTSDIAISYYKTVIGLGMQLFAMI 227 Xylella fastidi...
tigr:BRA0366 159 ---PITSVVVAVSALIVPM---C-FTFIAALVFVTLVEAYVIINAAVLFMGFGGSQWTREYALAPIRYAVAVGAKLFVLT 231 Brucella suis 1330
AAC82634     155 ---DNALAIAAVFAMVVVV---VsFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFAVRYLVYAFSVGMKLMALV 228 Agrobacterium f...
BAC53547     138 ---NFVQIAVLMVSWLLVL---IaFFILAVQLFVTLIEFKLTTLAGFILIPFALFNKTAFLAEKVLGNVVASGVKVMVLA 211 Bradyrhizobium ...
CAG37880     231 ---PIDATFILLGVLVIAI---C-AAFITVTIVCILIEAYFVLNISVILLGFGALKFTREFTWNYLKYILSVGLKLLTIK 303 Desulfotalea ps...
WP_012607152 178 ssnPASLLVETLLAGIIGLlagVgILVMALEFLMVQIESYLVIALGVIMLAGGGLRWTAKYVGSYFDYAINVGVRLFILT 257 Acidithiobacill...
CAG23463     219 LII-IIGYSMFSGFMT-----QAGTGSADYLVMVGMCIVYFALVRVVPNMATSLATGRFV-----------FGSGSAVAA 281 Photobacterium ...
AAF84848     228 LII-GIGKSFIDQYYAav--sTGAITMKALLVMLVASIVLLALVNKIPPMFASIVGGGGAtag-----ignFGAGAAIAA 299 Xylella fastidi...
tigr:BRA0366 232 LIV-GLIMQVSAEWSA-----AYTNDEASLMTLVGLSLVCAYLTKTIPELIGGMISGTSMgggs---aiggMAAAGAAGA 302 Brucella suis 1330
AAC82634     229 MIA-KIGSDILIGLAEap--tATSDQFITTLAIAGISVVVFVIAMYVPPIIQGVVQGASV-------------SGGMEAI 292 Agrobacterium f...
BAC53547     212 VIV-GIGTGLFSQFTTay--aGGQPTIEQALSVVLAALAMLGLGIFGPGIATGLVSGAPQ-----------LGAGATVGT 277 Bradyrhizobium ...
CAG37880     304 VLA-NFISSFFASAHNplavpAGDIGIQYMIHAIICMVVITGIFKTIPTTVASFVTNAG------------IGSNPIGAV 370 Desulfotalea ps...
WP_012607152 258 ALAyLVTYSIVPLIQTil--eNVTNPLQAGFEVLILGALIALLPRKASSIASSLLSGNSSfsggelakeggMIAGGTVAL 335 Acidithiobacill...
CAG23463     282 ATSVAG--AAAGAALLGAGAFGAMKGGIGNL 310 Photobacterium profundum SS9
AAF84848     300 AATGAAv-AATAGSALAAGLSSAGGGVSALK 329 Xylella fastidiosa 9a5c
tigr:BRA0366 303 AAAIATv-ATSGAAAPAAGALGAAGTGGGAA 332 Brucella suis 1330
AAC82634     293 RHGGQTaaFAAGGAFLGAGA--AMKGAQSAS 321 Agrobacterium fabrum str. C58
BAC53547     278 GLAVAGt-AMVGGAALGLAGRGAMAASSGAA 307 Bradyrhizobium diazoefficiens USDA 110
CAG37880     371 VATVAGv-AATG---KMAGASSKKAGAVAAA 397 Desulfotalea psychrophila LSv54
WP_012607152 336 GAAGVGl-AAAAGGGLAAGGLSAAAGAGGGA 365 Acidithiobacillus ferrooxidans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap