Conserved Protein Domain Family
TrbJ_Ti

?
TIGR02780: TrbJ_Ti 
P-type conjugative transfer protein TrbJ
The TrbJ protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbJ is a homolog of the F-type TraE protein (which is believed to be an inner membrane pore-forming protein, TIGR02761) as well as the vir system VirB5 protein.
Statistics
?
PSSM-Id: 131827
View PSSM: TIGR02780
Aligned: 8 rows
Threshold Bit Score: 171.086
Threshold Setting Gi: 27356570
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG37879      14 IYNTMKKIYSLLIIVCLittiiakQDAKAGI-PVTCIncSNMFTQILEYANDIESLMEGIkryeelathttqnyNKISGD 92  Desulfotalea ps...
AAC82632       7 RPLEAARVAMITAIVILvafptyaGGVTGQAtEWTQL--ANNAELISLVGKSAEQVNNQItqis-------qlaEQIQNQ 77  Agrobacterium f...
CAI10546       4 KFLAAKATLVVALSA---------GPLAAHA-GIPVIdaANLSQTIMTAIESVAQTLKQI--------------EQYQTQ 59  Aromatoleum aro...
tigr:BRA0368  14 RKFGRDAALALAMASAGlgvslymAPAPAYA--IYCSncSTFYQQMYEYAEAVNTQLNTA--------------QQLQTQ 77  Brucella suis 1330
CAG23461       3 HPRYGQAWLLIAAMSST-------LSPPVMAwPVVCVncATNIQAMQASLAQAKDYVESV--------------QQTYNA 61  Photobacterium ...
BAC53549       2 TALEVRRAGLAAATALSlafsispLSTTSVLaQWIVYdpTNFSQNVLTAARELQQINNQI--------------QMLTNQ 67  Bradyrhizobium ...
CAD16287       4 RVLSVSLAAVLSVSLL--------AVQPASA--LTVFdpSNFVQNTLTAVRTLEQINNQI--------------NQLQNE 59  Ralstonia solan...
WP_012607150   1 -MSIQSKAVMLSVSLAL-------LPAPAFA--VSEVagATFPEQIVQEATSVQQLAKQAqevt-------tqiSMYAND 63  Acidithiobacill...
CAG37879      93 IKRYENMLKNTKSLPDN----MNTKLAIKLKYLTNDIKSTGVRYADFAALQ--DIFSQLYPDYQSVaksi--npnLSSKL 164 Desulfotalea ps...
AAC82632      78 INIYKNLLQNTAQLPNH----IWGQVENDLSKLQNIVAQGQGVAFSMGNID--DVLKQRFQSFADM---------KTNLP 142 Agrobacterium f...
CAI10546      60 LQQYENQIQNTMAPAAY----IWDRAQSTIN---GLMTAVDTLNYYKTQLGsvDGYLGKFQDVAYYrgspcfsgaGCSDT 132 Aromatoleum aro...
tigr:BRA0368  78 IQQYDNMIKQGMSLPSR----MFNTITGDLQRVASVYNSAQSLGRNISNLD--EQFRQQFKGYDSYl--------NSIGQ 143 Brucella suis 1330
CAG23461      62 IQSLRHQTTNLQRLGNM----DWGNTEQQLRNLSNIASQGQAMSYSIANLN--TRWNHHFQGMDGYe--------QQSID 127 Photobacterium ...
BAC53549      68 AQSLVNQGKNLANLPLS----TLTQLQSSIAKTQSLLSQAQNIAFNVERVQ--TMYSSTYGTA------------AATGS 129 Bradyrhizobium ...
CAD16287      60 AQMLMNQARNLTKLDFN----IVNRLRSTLATTERLIAEAQGLAYDVQSMD--ATFSRLYPEQY-----------AATIS 122 Ralstonia solan...
WP_012607150  64 IERYQNMVANTLNMPAAmyaqIWNPLVGSIQKLTSIYSQAQALGYAGQNIG--AELAQEYQGA---------------GS 126 Acidithiobacill...
CAG37879     165 TRKYTEDHYDTWAKEAQSVTGKAFSMSGDQLNDLVESGGFEDAVNDLISTPEGQKEALDASNQLAAMQLEEARNLRALLA 244 Desulfotalea ps...
AAC82632     143 DGQSFSSTYQGWSDTNRDTIAGTLKAANLTAEQFSSEESTMSSLRSLSESADGQMKALQVGHQIATQQVAQMQKLRGLVS 222 Agrobacterium f...
CAI10546     133 ERTAMNENRRLASESQKKANDALFRGLDRQQEALKADARTLEQLQSSAQGASGQMQALGYANQLASQQANQLLQIRGLLI 212 Aromatoleum aro...
tigr:BRA0368 144 GQNNMPQRYRDWAQSGFDNARTAMQAAGVNTSTFEDENALLDQLASRSQSAIGRQQAIQAGNEIAAQNVQQLQKLRDLVA 223 Brucella suis 1330
CAG23461     128 DINGIDNYRARG-DTLRDTAKSALSVANTMTGYQQEDNATLQRAQGHSAGAKGALQAAQANGELLAQVSRQLQKIQTLLQ 206 Photobacterium ...
BAC53549     130 NATMFAAAQSRW-QNSVGAFEDSLKVQAGVVGNISTNSSAMSTLVTASQSASGALQAAQAGNQLLALQSQQLSDLVAVLA 208 Bradyrhizobium ...
CAD16287     123 GDQMLRDAQERW-KNTLNGLHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAMQATNQLLALQAKQSIQAQQLQI 201 Ralstonia solan...
WP_012607150 127 SIQNLSSVYANWNQTTNTDMEDALESQHLAAQNFATQDASMQTIQNEAQTAQGREQVAAAAVAAANVTTKSIQQLEQITM 206 Acidithiobacill...
CAG37879     245 VSIQAQQQVAQKQQGIEYIQEQQSRNFWe-TREPTQTLNLP--HGW 287 Desulfotalea psychrophila LSv54
AAC82632     223 QQMTMMGTWFQSEQAQKDLAQARREQFFn-APTNDIRGGQTmePRW 267 Agrobacterium fabrum str. C58
CAI10546     213 AQQNAVATRMQAEADREAQTIAADEQF----RRGSYRASSG--QTW 252 Aromatoleum aromaticum EbN1
tigr:BRA0368 224 TQITLQGNYMAQQNERQSVSDASEQQF----RSRENTRGPS--EGF 263 Brucella suis 1330
CAG23461     207 ADIQMSSTYIASEVDRLDAEKVATNKLHrdAPNVNVTDGIDwsTKW 252 Photobacterium profundum SS9
BAC53549     209 AKGRADALEQARVTATESQGQQQYKIF---STRSGYQPGNV--TMF 249 Bradyrhizobium diazoefficiens USDA 110
CAD16287     202 TQDRAASLELARQAAATERAREVRRRFL--GTGTPYTPQSV--NFY 243 Ralstonia solanacearum GMI1000
WP_012607150 207 AGKDAQIAYLKQKKAEKNVTAQEAADGL--FSGGTNNPSLL--P-- 246 Acidithiobacillus ferrooxidans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap