Conserved Protein Domain Family
LigD_PE_dom

?
TIGR02777: LigD_PE_dom 
DNA ligase D, 3'-phosphoesterase domain
Most sequences in this family are the 3'-phosphoesterase domain of a multidomain, multifunctional DNA ligase, LigD, involved, along with bacterial Ku protein, in non-homologous end joining, the less common of two general mechanisms of repairing double-stranded breaks in DNA sequences. LigD is variable in architecture, as it lacks this domain in Bacillus subtilis, is permuted in Mycobacterium tuberculosis, and occasionally is encoded by tandem ORFs rather than as a multifuntional protein. In a few species (Dehalococcoides ethenogenes and the archaeal genus Methanosarcina), sequences corresponding to the ligase and polymerase domains of LigD are not found, and the role of this protein is unclear. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131824
View PSSM: TIGR02777
Aligned: 11 rows
Threshold Bit Score: 260.363
Threshold Setting Gi: 38258682
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB51222         4 LEQYHTKRDFKKTSEPAGKVARTGKNEAggIFVIHKHAATRLHYDLRLEHDGVLWSWAVTRGPSLDPHEKRLAVHVEDHP 83   Mesorhizobiu...
chgcsh:XC1808    3 LSEYRRKRSFDKTREPEPGKLLPQGQRA--IFVVQLHHASRRHYDFRLQVGDALKSWAVPKGPSYDPAVKRMAVEVEDHP 80   Xanthomonas ...
chgcsh:XC0109    3 LRDYTRKRRFDQTPEPAEDAAATAHRQP--IFVVQLHHASSRHYDFRLEADGVLKSWAVPKGPSLRAGEKRLAVQVEDHP 80   Xanthomonas ...
BAC52038         5 LSTYRQKRDFEKTPEPSGEAAVASSKQR--RFVIQKHDASRLHYDFRLEFDGVFKSWAVTKGPSLDPHDKRLAVEVEDHP 82   Bradyrhizobi...
CAC47322         8 LSEYNRRRDFTRTSEPKGAVARRSGDNRm-RFLVQKHAATRLHYDFRLEWEGVLKSWAVTRGPSLNPEDKRLAVRTEDHP 86   Sinorhizobiu...
AAL45426         3 LQTYNAKRSFDKTPEPKGTKAEKPGS----SFVIQKHDARRLHYDFRLEMDGVLKSWAVTRGPSLDPEDKRLAVHVEDHP 78   Agrobacteriu...
AAN68867         5 LQEYARKRDFNATPEPSGKRKRGKRAHAl-QFCIQKHDASHLHYDFRLELDGTLKSWAIPKGPSLDPKVRRLAVHVEDHP 83   Pseudomonas ...
CAF24557         3 LKKYLSKRNFNETTEPHEKTKEHSSQSL--LFVVQMHNASHLHYDFRLELDGVLKSWAIPKGPSLNPNDKRLAIQVEDHP 80   Candidatus P...
tigr:DET0850     6 LEEYNRKRDFNKTAEPSGTKSPPSANP---VFVVQKHLASHLHYDFRLEIDGVLKSWAVPKGPSASPKEKRLAVATEDHP 82   Dehalococcoi...
P59971         297 LTRYRRMRDASKTPEPIPTAKPVTGDGN--TFVIQEHHARRPHYDFRLERDGVLVSWAVPKNLPDNTSVNHLAIHTEDHP 374  Mycobacteriu...
WP_028005462     6 LEAYRKKRDFSKTPEPVGNLT-AGGN----RFVVHKHHATADHYDLRLEVDGVLKSWAVPKGPSLNPADKRLAVETEDHP 80   Sinorhizobiu...
BAB51222        84 IDYAPFEGTIPKGEYGGGSVIVWDEGTWMPETDPAK---------AMKKGHISFELNGHKLHGLWHLVRLKp-RAGEKr- 152  Mesorhizobiu...
chgcsh:XC1808   81 VDYASFEGEIPKGEYGGGHVAQFDHGVWATAGDPEA---------QLAKGHLRFELFGSKLKGGWHLVRSS--KPARQ-- 147  Xanthomonas ...
chgcsh:XC0109   81 LAYAGFEGDIPQGQYGAGHVQVFDHGTWHCDGDALA---------ALDAGKLDFDLQGDKLRGGFALVRTR--LRGRQ-- 147  Xanthomonas ...
BAC52038        83 LDYGDFEGTIPEGQYGGGTVMLWDRGTWEA-DDPER---------GFKKGDLKFTLHGEKLHGSWVLVRMRndRDGGKr- 151  Bradyrhizobi...
CAC47322        87 LAYGDFEGTIPKGEYGGGTVMLWDTGWWEPEDDPSK---------ALKKGKLSFKLHGSRMKGGWALVRMRp-REGEKr- 155  Sinorhizobiu...
AAL45426        79 LSYGDFEGVIPKGQYGGGTVIVWDRGIWQPIGDAGK---------GYRKGHLEFELEGEKLKGRWHLVRMHg-KPGESr- 147  Agrobacteriu...
AAN68867        84 LDYADFEGHIPEGHYGAGDVIVWDRGIWEPEGDAHE---------AYAKGKLRFRLLGEKLGGVWNLFRTH--LAGKK-- 150  Pseudomonas ...
CAF24557        81 YSYHNFEGTIPKGNYGAGEVIVWDKGNYSALGAKSQkeseqfirqGLKKGHLKFVLNGHKLKGEFSLIRFQ----GDD-- 154  Candidatus P...
tigr:DET0850    83 MQYASFEGVIPAGEYGAGKVIVWDRGTFQNLKDGKTle------eSYSTGHLVINLQGEKLKGGYSLLRTK--------- 147  Dehalococcoi...
P59971         375 LEYATFEGAIPSGEYGAGKVIIWDSGTYDTEKFHDD----------PHTGEVIVNLHGGRISGRYALIRTN----GDR-- 438  Mycobacteriu...
WP_028005462    81 LDYIDFEGVIPEGEYGGGPMIVWDKGVWAPMGDVDD---------DLRKGAFKFRLAGEKLNGGWMLARLKr-RPGEEdq 150  Sinorhizobiu...
BAB51222       153 DNWLLIKSDDA 163  Mesorhizobium loti MAFF303099
chgcsh:XC1808  148 PQWLLFKEDDA 158  Xanthomonas campestris pv. campestris str. 8004
chgcsh:XC0109  148 PQWLLIKRDDA 158  Xanthomonas campestris pv. campestris str. 8004
BAC52038       152 TNWLLIKHRDE 162  Bradyrhizobium diazoefficiens USDA 110
CAC47322       156 ENWLLVKETDD 166  Sinorhizobium meliloti 1021
AAL45426       148 ENWLLIKGDDE 158  Agrobacterium tumefaciens str. C58
AAN68867       151 EQWMLVKSHDA 161  Pseudomonas putida KT2440
CAF24557       155 KQWLLIKKSDV 165  Candidatus Protochlamydia amoebophila UWE25
tigr:DET0850   148 MGWLMVKMEDE 158  Dehalococcoides mccartyi 195
P59971         439 --WLAHRLKNQ 447  Mycobacterium bovis AF2122/97
WP_028005462   151 RNWLLFKERDP 161  Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap