Conserved Protein Domain Family
nickel_nikD

?
TIGR02770: nickel_nikD 
nickel import ATP-binding protein NikD
This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131817
View PSSM: TIGR02770
Aligned: 7 rows
Threshold Bit Score: 330.485
Threshold Setting Gi: 34483091
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
novoz:BL02421  27 LVQDINFDLKRGQVLGLIGESGCGKTVTSMSILQTLDpKTTKVEGSIALRGRELNGLadkemrKIRGKDIAYIMQNPMNA 106 Bacillus liche...
CAE10090       22 LVQGVSFSLKENHCIGILGESGSGKSLTCKAILGLLG-EDFEVRGEVRFKGRNLLELpreereRIRQRELCMVIQSPMTA 100 Wolinella succ...
AAM06824       34 AVVDLNLVAKMGKITALVGESGSGKSTVALAVMGIQDkNAIISSGEIYLAGMDVLSIpkkdmrSYISNHAGIIFQDPIDS 113 Methanosarcina...
CAC24696       17 LVDNLSLGVQRGRILALVGASGSGKSMTCSAALGVLPpGVTASRGRVTIDGVPYAAN------ALRGRHVATIMQNPRGA 90  Brucella suis ...
P33593         18 LVHGVSLTLQRGRVLALVGGSGSGKSLTCAATLGILPaGVRQTAGEILADGKPVSPC------ALRGIKIATIMQNPRSA 91  Escherichia co...
Q88HL1         20 LVHDVDLQLRRGEVCTLVGASGSGKSLSCLGLLDLLPpGLARTQGQLLLDGQPLAAS------SVRGRLTSLVLQNPRSA 93  Pseudomonas pu...
AAK69196      318 LVSHLNLSIKCGECVALLGKSGSGKSISALALQGFLAsNLSQTSGKIMLDDKVINPS------FYRSLAFSCIMQNPRTC 391 Helicobacter h...
novoz:BL02421 107 FTPVFTIGQQMTESIRSHTSFSkKQAKELATEALHHVNLPHPAKLLHSYPFQLSGGMLQRVMIAIASCLKPAILIADEPT 186 Bacillus liche...
CAE10090      101 FNPLFSMKNQMLETLMLALSLEtKKATKLILEAFEKVNLREGEEILEKYPHQLSGGMLQRIMIALCIALSPAVIIADEPT 180 Wolinella succ...
AAM06824      114 LNPLLTIGEQLMETILIHEKITkKQARAIALNQLLAVSLPQPEELMKKYPFMLSGGMCQRVMIAIASVFHPPLLIADEPT 193 Methanosarcina...
CAC24696       91 FNPVRTMRDHAIETLQALGKLS-SNPQDQIVHCMRAAGLEDVKTILSLHPFEMSGGMLQRMMIALALLSEAPFLFADEPT 169 Brucella suis ...
P33593         92 FNPLHTMHTHARETCLALGKPA-DDAT--LTAAIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPT 168 Escherichia co...
Q88HL1         94 FNPVRNMASHAIETLRQRGITS-AVARARMAHCLDAVGLADTERVLQSFAFQLSGGMLQRMMIALALMAETPFLLADEPT 172 Pseudomonas pu...
AAK69196      392 FNPLLSIAHHFKETLKSLHKPY-NQPF--IVQCLQESGLD--KQVLDMYPFELSGGMLQRVMIALALLTQAPFLIADEPS 466 Helicobacter h...
novoz:BL02421 187 TALDVYNQKTVLKYLDGMRSDFGTAILLISHDLGVIAEMADEVAVMQNGRIVENRDVFQLFD--EPKHEYTKKLLSARL 263 Bacillus lichen...
CAE10090      181 TAIDVANQVEVLKEFRRIRELFGTSMIFISHDLSVLSQIADELLVMCQGEVIERGTPKEIIV--NPTHKTSQELIGRRL 257 Wolinella succi...
AAM06824      194 TALDVTVQAQILYQLDSMRKRDGTAILLITHDLGVVAEIADEVCIMKDGQIVERGTVDDIFY--NPQNMYTRKLLAAAL 270 Methanosarcina ...
CAC24696      170 TDLDLVVQLRVLELLEKLVEERDLGILLVTHDMGVVARLAHDVAVLDHGRLIEQAPVMDIFQ--TPGHEVTRMLVSAHL 246 Brucella suis 1330
P33593        169 TDLDVVAQARILDLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSDGKIVEQGDVETLFN--APKHTVTRSLVSAHL 245 Escherichia col...
Q88HL1        173 SDLDALSQARFLDLLMELVQVHGLGVLLVTHDMGVVARCADQVAVMEAGRIVECQPAHELFQ--RPASATARTLLHAHQ 249 Pseudomonas put...
AAK69196      467 SDLDKDIAFEILKTLRELQQQRGLGILLITHDLRVVAYMAQYVYVMDKGKIIEEVSLCKDFYsySPKSTTIKHLKHICE 545 Helicobacter he...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap