Conserved Protein Domain Family
nickel_nikE

?
TIGR02769: nickel_nikE 
nickel import ATP-binding protein NikE
This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131816
View PSSM: TIGR02769
Aligned: 4 rows
Threshold Bit Score: 412.277
Threshold Setting Gi: 60390563
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB04290   2 SLLEVRDVTHTYRTSLLFWrAKQRAPVLTNVSLSIEEGMCMGLLGTSGAGKSTLGKVILGLAKPQKGTVFFQGQDLYQMD 81  Bacillus halodurans...
Q8FVN0     2 SLISADNIVKIYQSHSLVG-ASARKTVLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLD 80  Brucella suis 1330
P33594     2 TLLNISGLSHHYAHGGFNG-KHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVGLESPAQGNISWRGEPLAKLN 80  Escherichia coli K-12
Q88HL0     2 SLLHVHHVGHRYRTGGLLR-KRGWLQVLDGIDLQLHAGESIGLLGSSGSGKSTLARLLLGLEKPAQGQVSFAGQDVSQLK 80  Pseudomonas putida ...
BAB04290  82 PKSRRRVRRDLQVVFQDCYSSVNPRMTAEQIIGEPLENYERLSASEQKRKIAHLLDMVGLRSDDMRKYPREFSGGQLQRI 161 Bacillus halodurans...
Q8FVN0    81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160 Brucella suis 1330
P33594    81 RAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLLSLKKSEQLARASEMLKAVDLDDSVLDKRPPQLSGGQLQRV 160 Escherichia coli K-12
Q88HL0    81 GEQARAFQRTVQLVFQDAPGAFNPQRSIGWSIAEPLRHLTDMDEAARQARTLALLEEMGLRAEHAQRLPQQLSGGQLQRA 160 Pseudomonas putida ...
BAB04290 162 NIARAIALKPKLIVLDESVSSLDMVNQTVILELLRELKAAFGLSYLFITHDIKAAYSISDELAVMEKGQLIEQCkDKAQL 241 Bacillus halodurans...
Q8FVN0   161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEI-KTADL 239 Brucella suis 1330
P33594   161 CLARALAVEPKLLILDEAVSNLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQ-VVGEK 239 Escherichia coli K-12
Q88HL0   161 NIARALAASPQLVVLDEALSNLDRLLQLQILQQLEALRQRSGTAFVLISHDLSLVQYFCQRVVLLHGGRIVEER-PVTHD 239 Pseudomonas putida ...
BAB04290 242 FSSKHPAVKNLLSSILSEHPRHRSIST 268 Bacillus halodurans C-125
Q8FVN0   240 DSMRHPASRLLREAVLPPLPVRAVETN 266 Brucella suis 1330
P33594   240 LTFSSDAGRVLQNAVLPAFPVRRRTTE 266 Escherichia coli K-12
Q88HL0   240 LCFAHPVGRQLQAAVLPVRPQRRPSPQ 266 Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap