Conserved Protein Domain Family
TraG-Ti

?
TIGR02767: TraG-Ti 
Ti-type conjugative transfer system protein TraG
This protein is found in the Agrobacterium tumefaciens Ti plasmid tra region responsible for conjugative transfer of the entire plasmid among Agrobacterium strains. The protein is distantly related to the F-type conjugation system TraG protein. Both of these systems are examples of type IV secretion systems.
Statistics
?
PSSM-Id: 131814
View PSSM: TIGR02767
Aligned: 3 rows
Threshold Bit Score: 1051
Threshold Setting Gi: 2499037
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAF26531   7 QLALILMPIALGALTIFLVPHLLSFMIN-DLKANHVYWYVRSEPLLVLMLVATVSLCYTLSQKLHLR-KAITLVSAVFFG 84  Bartonella quintana...
Q44346     5 RLLLLILPAIIMLAAMFATSGMEQRLAAfGTSPQAKLMLGRAGLALPYIAAVAIGIIGLFAANGSANiKAAGLSVLAGSG 84  Agrobacterium fabru...
AAL45798  10 SLLLITIPIAVTGFSFYVAHWRWPELAA-GITGKTQYWFLRASPLPVLLFGPLAGLLAVWALPLHRR-RPVALASFLCFF 87  Agrobacterium tumef...
CAF26531  85 ITALYFIGGEIKRLTPyVGQQGITWSYALKFMDPMVVFGVICGVVLLVIQVMIS-------SPPTSKVKRAKKGIFGDAS 157 Bartonella quintana...
Q44346    85 VVITIATLREVIRLNS-IASSVPAEQSVLAYADPVTMIGASIAFISGMFALRVAikgnaafATTAPKRIGGKRAVHGEAD 163 Agrobacterium fabru...
AAL45798  88 LVAGFYGMREFGRLQPlVESGVLTWDQALSFVDMIAVVGAAMGFMAAAVAARIS-------SVVPEQVTRARRGTFGDAD 160 Agrobacterium tumef...
CAF26531 158 WMNLKEAAKIFPANGQIVVGERYRVDQDGVCNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVP 237 Bartonella quintana...
Q44346   164 WMKIQEAAKLFPERGGIIIGERYRVDRDSVAAMPFRADDRQSWGAGGKSPLLCFDGSFGSSHGIVFAGSGGFKTTSVTIP 243 Agrobacterium fabru...
AAL45798 161 WLPMSAAARLFPDDGEIVIGERYRVDKELIHELPFDPNDPATWGRGGKAPLLTYAQDFDSTHMLFFAGSGGFKTTSNVVP 240 Agrobacterium tumef...
CAF26531 238 TCLTYPGPIVCLDPSTEIAPMVRFARKKMGnRNVIVLDPNSLLTkNFNVLDWLLDDSvprTQREANIVGFSKLLLTDK-K 316 Bartonella quintana...
Q44346   244 TALKWGGGLVVLDPSSEVAPMVCEHRRQAG-RKVIVLDPTAGGV-GFNALDWIGRHG---NTKEEDIVAVATWIMTDNpR 318 Agrobacterium fabru...
AAL45798 241 TALRYTGPLICLDPSTEVAPMVVDHRRDKLdREVVVLDPANPVM-GFNVLDGIEHS----LKKEEDIVGIAHMLLSESvR 315 Agrobacterium tumef...
CAF26531 317 SENSSAEYFSTQAHNLLTALLAHVIFSDEYEDSERNLKTLRAILSQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQ 396 Bartonella quintana...
Q44346   319 TASARDDFFRASAMQLLTALIADVCLSGHTETEDQTLRRVRANLSEPEPKLRARLTKIYEGSESDFVKENVSVFVNMTPE 398 Agrobacterium fabru...
AAL45798 316 FESSTGSYFQSQAHNLLTGLLAHVMLSPEYAGQ-RNLRSLRQIVSEPENSVLAMLRDVQEHSASAFIRETLGVFVNMTEQ 394 Agrobacterium tumef...
CAF26531 397 TFSGVYTTASKDTQWLSLSNYADLVCGNDFSSSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGKYKKRV 476 Bartonella quintana...
Q44346   399 TFSGVYANAVKETHWLSYPNYAGLVSGDSFSTDDLADGGTDIFIALDLKVLEAHPGLARVVIGSLLNAIYNRNGNVKGRT 478 Agrobacterium fabru...
AAL45798 395 TFSGVYSTASKDTQWLSLDNYAALVCGNTFKSSEIAGGKKDVFINIPASILRSYPGIGRVIIGSLINAMIEADGAFTRRA 474 Agrobacterium tumef...
CAF26531 477 LFVLDEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFG-EAGARSWFESCSFVSYAAIKDLQTAKDISERCGQ 555 Bartonella quintana...
Q44346   479 LFLLDEVARLGYLRILETARDAGRKYGIMLTMIFQSLGQMREAYGgRDATSKWFESASWISFAAINDPDTADYISKRCGD 558 Agrobacterium fabru...
AAL45798 475 LFILDEVDLLGYMRVLEEARDRGRKYGVSMMLMYQSVGQLERHFG-KDGAVSWIDGCAFASYAAIKALDTARNVSAQCGE 553 Agrobacterium tumef...
CAF26531 556 MTVEVTGTNKSRG----LSLGKSSYNVNYQQRALILPHEIIQeMRQDEQIILMQGQPPLRCGRAIYFRRKEMLAAANKNR 631 Bartonella quintana...
Q44346   559 TTVEVDQTNRSTG----MKGSSRSRSKQLSRRPLILPHEVLH-MRSDEQIVFTSGNPPLRCGRAIWFRRDDMKACVGENR 633 Agrobacterium fabru...
AAL45798 554 MTVEVKGSSRNLGwgtkNSASRKSENINFQRRPLIMPHEITQsMRKDEQIIIVQGHSPIRCGRAIYFRRKDMDMHARPNR 633 Agrobacterium tumef...
CAF26531 632 F 632 Bartonella quintana str. Toulouse
Q44346   634 F 634 Agrobacterium fabrum str. C58
AAL45798 634 F 634 Agrobacterium tumefaciens str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap