1U3C


Conserved Protein Domain Family
crypt_chrom_pln

?
TIGR02766: crypt_chrom_pln 
Click on image for an interactive view with Cn3D
cryptochrome, plant family
At least five major families of cryptochomes and photolyases share FAD cofactor binding, sequence homology, and the ability to react to short wavelengths of visible light. Photolysases are responsible for light-dependent DNA repair by removal of two types of uv-induced DNA dimerizations. Cryptochromes have other functions, often regulatory and often largely unknown, which may include circadian clock entrainment and control of development. Members of this subfamily are known so far only in plants; they may show some photolyase activity in vitro but appear mostly to be regulatory proteins that respond to blue light.
Statistics
?
PSSM-Id: 131813
View PSSM: TIGR02766
Aligned: 5 rows
Threshold Bit Score: 893.063
Threshold Setting Gi: 28201254
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U3C_A     15 IVWFRRDLRVEDNPALAAAVRAG-PVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT-CLITKRSTDSVAS 92  thale cress
BAB70688   21 VVWFRRDLRVEDNPALAAAARAGgEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDASLRRLGAgKLVTRRSADAVVA 100 Japanese rice
Q43125     15 IVWFRRDLRVEDNPALAAAVRAG-PVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT-CLITKRSTDSVAS 92  thale cress
Q96524      8 IVWFRRDLRIEDNPALAAAAHEG-SVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGS-DLTLIKTHNTISA 85  thale cress
XP_506872   8 VVWFRRDLRIDDNPALASAARDG-AVLPVFIWCPADEGQFYPGRCSRWWLKQSLPHLSQSLESLGC-PLVLIRAESTLEA 85  Oryza sativa (japo...
1U3C_A     93 LLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDP 172 thale cress
BAB70688  101 LLQLVRDTGATRLFFNHLYDPISLVRDHRLKEMMAAEGIIVQSFNADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDP 180 Japanese rice
Q43125     93 LLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDP 172 thale cress
Q96524     86 ILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIES 165 thale cress
XP_506872  86 LLRCIDSVGATRLVYNHLYDPVSLVRDDKIKKELSALGISIQSFNGDLLYEPWEIYDDSGLAFTTFNMYWEKCMELPIDA 165 Oryza sativa (japo...
1U3C_A    173 eSPLLPPKKII-----SGDVSKCVADPLVFED-DSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSAT 246 thale cress
BAB70688  181 aAPLLPPKRIN-----SGDLSMCPSDDLIFED-DSERGSNALLARAWSPGWQNADKALTAFLNGPLIHYSVNRKKADSAS 254 Japanese rice
Q43125    173 eSPLLPPKKII-----SGDVSKCVADPLVFED-DSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSAT 246 thale cress
Q96524    166 -VMLPPPWRLMpitaaAEAIWACSIEELGLEN-EAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNS 243 thale cress
XP_506872 166 -SPSLAPWKLVpv-pgLESVRSCSVDDLGLESsKDEESSNALLMRAWSPGWRNAEKMLEEFVSHGLLEYSKHGMKVEGAT 243 Oryza sativa (japo...
1U3C_A    247 TSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYSRYISFNHPYSHERPLLGHLKFFPWAV 326 thale cress
BAB70688  255 TSLLSPYLHFGELSVRKVFHLVRMKQLVWSNEGNRAAEESCTLFLRSIGLREYSRYLSFNHPCSHEKPLLAHLRFFPWVI 334 Japanese rice
Q43125    247 TSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYSRYISFNHPYSHERPLLGHLKFFPWAV 326 thale cress
Q96524    244 TSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDA 323 thale cress
XP_506872 244 TSLLSPYLHFGEVSVRKVYQLVRMQQIKWENEGTSEAEESIHFFMRSIGLREYSRYLCFNFPFTHEKSLLGNLKHYPWKV 323 Oryza sativa (japo...
1U3C_A    327 DENYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGT 406 thale cress
BAB70688  335 NECYFKIWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGS 414 Japanese rice
Q43125    327 DENYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGT 406 thale cress
Q96524    324 DVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGS 403 thale cress
XP_506872 324 DEERFKSWRQGMTGYPLVDAGMRELWATGWTHNRIRVIISSFAVKFLLIPWTWGMKYFWDVLLDADLESDILGWQYISGS 403 Oryza sativa (japo...
1U3C_A    407 LPDSREFDRIDNPQFEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEAKARLHE 486 thale cress
BAB70688  415 LPDGRELDRIDNPQLEGYKFDPHGEYVRRWLPELARLPTEWIHHPWDAPASVLQAAGVELGSNYPLPIVGLDAANARLQE 494 Japanese rice
Q43125    407 LPDSREFDRIDNPQFEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEAKARLHE 486 thale cress
Q96524    404 IPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAK 483 thale cress
XP_506872 404 LPDGHELSRLDNPEVQGQKYDPDGVYVRTWIPELARMPTEWIHHPWDAPSCILEVAGVELGFNYPKPIVDLHIARECLDD 483 Oryza sativa (japo...
1U3C_A    487 ALS 489 thale cress
BAB70688  495 ALS 497 Japanese rice
Q43125    487 ALS 489 thale cress
Q96524    484 AIS 486 thale cress
XP_506872 484 SIS 486 Oryza sativa (japonica cultivar-group)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap