Conserved Protein Domain Family
TraE_TIGR

?
TIGR02761: TraE_TIGR 
type IV conjugative transfer system protein TraE
TraE is a component of type IV secretion systems involved in conjugative transfer of plasmid DNA. The function of the TraE protein is unknown.
Statistics
?
PSSM-Id: 163004
View PSSM: TIGR02761
Aligned: 8 rows
Threshold Bit Score: 205.303
Threshold Setting Gi: 46400698
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
cucgc:lpg2091    1 MKiEQKKSELMKEKKIRVLFIGI-SSVLLAMTFMQSITIVVLlhyaHSKHETHFIPPKISQEFTLSGTGVSEGYLRDMTN 79  Legionella pn...
CMCP6:VV2_0633   1 MD-NQHQGNLLALSKLLNFLLVFgFAASMLVNVVLGLSLAKT----LSEKSRTLVPPTISQAFTISDTAIDAPYLQLMGE 75  Vibrio vulnif...
CAI09899         1 MDfERLNGDIKEM-RRRNRGLGL-AVGVLAAGQILALVVILNl---LGTVRTVVVPPALNQTFWVTRDQASHEYLEQMGS 75  Aromatoleum a...
CAH17335         1 MDfKSYQSRLSQLSARFNLMVVL-VFGLLISNVLLSCFLFKA----WNQHTIEVTPFSGAPSYLKSASSVDGHYLSLMAE 75  Legionella pn...
CAF24147         1 MErIFFERNLNHLLVQRNFLVGL--SLTLLMGVILAVSFLC-----FKTERIIIVPSTIEKEFWVDAHSVSATYLEQFGL 73  Candidatus Pr...
AAL23484         1 MEhGARLSTSRVLAISFIFMALL-IVLSLAVNVIQGINNYRL----QNEQRTAVTPMGFNASFAVSQNSADASYLQQMAL 75  Salmonella en...
WP_012606789     1 MKfELFKKDYEGL-LRNNRAFLI-VIGVLAVVVLMQQWAIVT-----EKTRMVLVPPYIDKAVKIGYASADADYYESWGL 73  Acidithiobaci...
WP_012675173     1 MKyIERWSELYR--KNAILLFVV-FLQAVLIVFLLTAVLYLA----VKRTAVIAIPPTGTQI-----ATGSETHRLLWGR 68  Persephonella...
cucgc:lpg2091   80 FLTQLRFNITSSSATYQFNALLGYVAPSLYGDIRAQLVKEVEQINHEHLSSVF--YPSTFEIDIKHLSVKVMGQMKRFVG 157 Legionella pn...
CMCP6:VV2_0633  76 YFLKLKLNVTPANVFRQYGLLLDYVPTENWSTIQPVLVKDAEHLKKYNTTSRFdaLPGRTEISIENRQFKQTGHLTKTVG 155 Vibrio vulnif...
CAI09899        76 FIAWLILDVTPASIDWKKGVLLGYVEPEQYGPLKTRQEVEAERLKRINAATVF--APQQLVPSEAAQSVVIRGRLRTLVN 153 Aromatoleum a...
CAH17335        76 NFVNERLSVTPETVDASHQRLLSYVGHQNYNQMLRLLTNEAKVIKDKKMSSIF--YIDKNKANPHELTVVVSGILKRFVG 153 Legionella pn...
CAF24147        74 FLGQLLLTKSSYSADLHRNILCRHTEPQYLALLKQRLMEEEETLKKQNASYVF--YLNNVHVNPKELTVTLLGDRQFFLA 151 Candidatus Pr...
AAL23484        76 SFIALRLNVSSETVDASHQALLQYIRSGAQNQMKVILAEEARRIKADNVNSAF--FQTSVRVWPQYGRVEIRGVLKTWIG 153 Salmonella en...
WP_012606789    74 YVSELMGNLTPGDAPFVEKAMGKLFSSVSYEGVKSRIAQSAAEEANADATFAF--EAKSVIWQSQTGTVFVHGTLRQVNG 151 Acidithiobaci...
WP_012675173    69 YYIDLLMNFSKNDIDNRLNILFTFIQNP---KARERLIREAEEIKKNDIVQVF--IPYESTWKVQGGVVSVKGHIKRWIG 143 Persephonella...
cucgc:lpg2091  158 -ADLMSDVRETFLIRYSYEYGLLKLTNLE 185 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
CMCP6:VV2_0633 156 -DRTLPSELVTYTVQMDYSNGVIELIGIK 183 Vibrio vulnificus CMCP6
CAI09899       154 -GFETANELKAYLIEFSYAGARMHLKAFK 181 Aromatoleum aromaticum EbN1
CAH17335       154 -LQALNDERKTYVLQFQYKDSRLSIVQFA 181 Legionella pneumophila str. Lens
CAF24147       152 -GQQTTLESCGYTLHFNYSGARLLLKGIT 179 Candidatus Protochlamydia amoebophila UWE25
AAL23484       154 -DSKPFTDIKHYILILKRENGVTWLDNFG 181 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
WP_012606789   152 aGRTISATPFTFSMRVHIAAGRPVLDDFH 180 Acidithiobacillus ferrooxidans
WP_012675173   144 -TTLVRDEDVLVKVKLRPSGSIIALEDWK 171 Persephonella marina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap