Conserved Protein Domain Family
TraD_Ftype

?
TIGR02759: TraD_Ftype 
type IV conjugative transfer system coupling protein TraD
The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM).
Statistics
?
PSSM-Id: 131806
View PSSM: TIGR02759
Aligned: 7 rows
Threshold Bit Score: 819.716
Threshold Setting Gi: 46400716
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC97747       16 FTRGGQITFHSIRMFFQVNNTLVYAAIWAVIALTGFLTWLRAPDN----------AF-WSVFYYWRNQLYANLgHDLNSE 84  Vibrio vulnifi...
CAG17957       11 YTRGGQITFHNITMFFQINAKLVRWMGYGILLLTALLCFSFIDQD----------TL-KGTYYYWRYSMVGKI-KPDTHE 78  Photobacterium...
CAH17350       10 YTRGGQISFHNLRMWDQITKTLVWVCLFLWVVLTGLITWLVISPE----------KF-HQAIAYYYASFLNLVgQ--KHT 76  Legionella pne...
AAS58908        8 MTQGGQIASMRIRMFSQIANIIFYCLFIFFWILVGLVLWVKLSWQ----------TFvNGCIYWWCTTLEGMRdLIKSQP 77  Salmonella ent...
CAH17215       12 FMSGGQIFDYKTKMMIQVSQRIFHWAVLGFVVLFSLIMAFYASSElklvvlnhisRF-LVKFHYGEYVLWTNLnGSKITA 90  Legionella pne...
cucgc:lpg2078  10 FIRGGQIFLHNVRMFTQVGKKVSLAMLIVFFIFSVIAFYFNTSAY----------QRyIGQQ-WVKAQAMTLIqSKAKQV 78  Legionella pne...
CAF24165        7 ITEGGQLTTHSVRMFKQVTKTSFFITFVLWIIVF---LYQMRDVN----------TFyLQNVLYFEQARFYQVlHIDTIK 73  Candidatus Pro...
BAC97747       85 VTTF-WNG--------KRYVGTLASQLENTQLITLYDNVIRQAQINFLIALAIAFAILMGAMTFFKRQGEKQSEDLHVRG 155 Vibrio vulnifi...
CAG17957       79 VFTL-WQG--------VTYKSTLGQQRLNPVFIDANRQFWLSLQLYLLASLISGLTVFSLAMRYFKKKGDEQTDDHFIRG 149 Photobacterium...
CAH17350       77 FTLP-FHG--------KNYQQNVETILHYPYYKENADHMVDLLGKSSLAAFVFSFVLGLCFAFYFIHRGKAQRANQFIRG 147 Legionella pne...
AAS58908       78 IYEIrYYG--------QTFRMNAAQVLQDKYTVWCGEQLWSAFVLAACVALVICLITFFMATWILGRQGKQQSEDDVTGG 149 Salmonella ent...
CAH17215       91 LF-------------------YQKSPLIQASVQQALDALWRKAQVSLFFGGAVYLLITLLFSRFFIKLGEKYTKDQFVSG 151 Legionella pne...
cucgc:lpg2078  79 VRMP--TG--------ESYPVYSAQIVKAPMVIGIVNQLKQALLKSMIEALFASVMMLIVMVKWLQKRGENQSKAKIIRG 148 Legionella pne...
CAF24165       74 VDPS--FGlqrgsqdvKEYTTDQVLRLTKPYADRFYRITKQRFQHSAFWALAPLSVVFAIFFF----RGRQSIKKHHLKG 147 Candidatus Pro...
BAC97747      156 FQY-AEPKRLTQDLKQRAKKlkkqgvgngkiSDFKVDGLALFKHEFEVQHILIDGTTGAGKSVMLRKLLRWIRKRGDKAI 234 Vibrio vulnifi...
CAG17957      150 IQI-ATPPELARILKKANKQ-----------SDFALDGHKIFKQHFECQHLLFDGTTGSGKSVALRKFLRWIKNRGDKAI 217 Photobacterium...
CAH17350      148 SRI-DTKENVIQQILDKKEN-----------SDITIDGFPL-KANSEVQHLLVHGTVGTGKSQLIMKIMDALRKRGDRVI 214 Legionella pne...
AAS58908      150 RQLtDNPKDVARMLKKDGKA-----------SDILIGDLPIIK-DSEIQNFLLHGTVSTGKSEIIRRLANYARQRGDMVV 217 Salmonella ent...
CAH17215      152 TRLaSSPKETIKSVNESQRGa----------SEIKLLNRLPMPKYSEKQGMLFHGTTGAGKTQAMMMLLEQIRALGEPAI 221 Legionella pne...
cucgc:lpg2078 149 SEL-VDENTLQKCIKKTSRI-----------SPYRIGGVSL-PFGSETQHIQIVGTTGSGKTVAIRDLLTTIQARGERAI 215 Legionella pne...
CAF24165      148 NTL-SSVWLTRWKLKLSRRA-----------SPISIGSLPLIK-GTETQHIMITGGTGSGKTNCLHHLLKSVRQQKQRAI 214 Candidatus Pro...
BAC97747      235 VYDKGCTFTSKFFDPSQDILLNPFDERCANWDVWCDAKEAPDFENIANALIPQHGEG--DPFWVDSARTIFSSTAYRMSQ 312 Vibrio vulnifi...
CAG17957      218 IYDKGCTFVSKFYNPETDIILNAFDERCAYWDVWCDAKDATDFENMSAALIPMHGDG--DPFWVQSARTIFTSTAYKMVN 295 Photobacterium...
CAH17350      215 VYDKGCAFIPHYFDSNQDVILNPFDARCPNWDMWLEAPRDSDFENMAESLIPMHGDS--EPFWVNAARTVFSSVAAKMRK 292 Legionella pne...
AAS58908      218 MYDRSCEFVKSYYDPSIDKILNPCDARCAAWDLWRECLTLPDFDNAANTLIPMGTKE--DPFWQGSGRTIFAEAAYLMRN 295 Salmonella ent...
CAH17215      222 IYDKECTIKPYFFDERIDVELNPISELCANWKMWRECANPLEFGSFATYLIPKSVQGs-DPFWVDSARTIFTSMAWKIRD 300 Legionella pne...
cucgc:lpg2078 216 IYDKGGTYLSRFYREHQDVILNPLDTRGHSWNVWAECEDKADLEALAEAIMPMPINNtmDPFWIKAARMIFVSTANELKN 295 Legionella pne...
CAF24165      215 IVDTTGLLTERYYRAGKDILLNPLDSRGAPWHPWIECIDKTSYATMAESFIPQSLSDs-DNYWRTSARIVLGSLFEQLKD 293 Candidatus Pro...
BAC97747      313 DNKPcSTARLLSLILTSELETLGNFLQGTESASLVSKDIKKTAISIKSVLATYIKSLRFLDGLDEKDehgklkRQPFSIT 392 Vibrio vulnifi...
CAG17957      296 EPNR-TTERLLELMLTSELESLSEYLKGTESASLVSDKIQKTAISIKSVLAAYIKSLRFLEGLDRKDdqgnlvRPRFSIR 374 Photobacterium...
CAH17350      293 DKDR-SVEKLLKLLLTGEFSHLEDYLKGTAAATLVSGKIEKTAISIRSVITTYLKSLSTLSGLDSEG------ASPFSIR 365 Legionella pne...
AAS58908      296 DSYR-SYSKLVDTLLSIRIEKLRTYLRDSPAANLVEEKIEKTAISIRAVLTNYVKAVRYLQGIERNG-------EPFTIR 367 Salmonella ent...
CAH17215      301 YAEK-DPVFLLQLLLTTSLEEIRNILKGTESENLVSKEIEKTAISIKSVLATYTKALRFLEGLDKSG------KEDFSIK 373 Legionella pne...
cucgc:lpg2078 296 DPKR-SNLMLLQYLLTADLGRIHHLLRHTESESLVSDKVQKTALNVKTVMATYLKSLLYLKDDG----------DIFSIR 364 Legionella pne...
CAF24165      294 IQKN---STLADKILRDPLQELCDFVQGTKAASLIDMNSEKTAASIRAVMSNFLTCFELLANTD----------QPFSIR 360 Candidatus Pro...
BAC97747      393 DW---VLDDKQ--RGFLFLSSNAQQHASLRPLISTWLAIASNAILGLDPDDDRRIWVIMDEMPSLHKLPELDSIIAEVRK 467 Vibrio vulnifi...
CAG17957      375 EW---VKNKDE--NGFLFLSSNAQQHASLRPLLSMWLSIASTSILEQEEDHDRRIWVVMDEAPSLHKLPELAETIAEVRK 449 Photobacterium...
CAH17350      366 DY---ILNEQH--SGWLFISSNGEQHKSLKPLMSMWLAMASLTLLSLTPNPDRRIWFICDELPSLHKLPLLGETIAEVRK 440 Legionella pne...
AAS58908      368 DWmrgVREDQK--NGWLFISSNADTHSSLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEIVPEARK 445 Salmonella ent...
CAH17215      374 EWienTTNPKKynKGWLFITSRSKYHKEIKPLISLWLGLAMQGVQSLVANNKGRIWLVMDELASLHRLETISDTLADIRK 453 Legionella pne...
cucgc:lpg2078 365 DW---ILNEQN--NSCLFVSSDGRKHPTIRPLISAWINTATKELLSLAPDDNRRVWFILDELATLHALPFLAAVKSESRK 439 Legionella pne...
CAF24165      361 EW---IQQEDPi-DNWLFISCKTNERAALNPLLSCWLSVAVRSLLALPPNFERRLWYIIDELPTLNRLRDLDMLLAESRK 436 Candidatus Pro...
BAC97747      468 FGGCYVIGLQSYAQLVKTYGKNT-ADVIFDLLNSRFYFRAPSAQMAQISSKDLGEQEVDVSRENISYGANTLRDGVSIGH 546 Vibrio vulnifi...
CAG17957      450 FGGCYVIGIQSFAQLKKIYGTNA-ALEMFDLLNTRFFFRSPSNEMAKISSQDLGEQEMDISKENYSYGAHAMRDGISLGH 528 Photobacterium...
CAH17350      441 FGGCFLLGMQSFSQLTKVYGQSGgAKELFDLLNTRFFFRSPSADMARLVASELGEEEIEESRENYSYGANSIRDGISLGS 520 Legionella pne...
AAS58908      446 FGGCYVFGIQSSTQMEDIYGEKA-AATLLDVMNTRAFFRSPSYKIADYVAHEIGEKEILKASEQYSYGADPVRDGVSTGK 524 Salmonella ent...
CAH17215      454 FGGCVAIGIQSIAQLDFIYGTHE-AGAIADLLNTSIYFRSPKSKVAKWVSEDLGSQVINEMKESQSYGPDSVRDGNTVGS 532 Legionella pne...
cucgc:lpg2078 440 FGGCFLLGHHGASQLRTIYGNDG-AASLSNLCSTRLFLRLPEHTDAEHASRNIGTYEIEEVNESISYGANTMRDGISVSR 518 Legionella pne...
CAF24165      437 YGGCAVLALQSPAQLEAIYGQAV-AQTLIGNCATKIVFAEQNPLHAGRLADMFGEQEIREYQKGLSYGANDIRDGVSLNQ 515 Candidatus Pro...
BAC97747      547 QTITRPVVSSSEIQAMDDLQCYLRVPGSSFITQLDLHFDKMRDVSAAFIKRDY 599 Vibrio vulnificus YJ016
CAG17957      529 QTITRPAVTPSEIMQLDDLQCWLRSPGDFPITKLDLKFDKMRSICPPFIRREY 581 Photobacterium profundum SS9
CAH17350      521 QRVTRPIVSYPQILELEDLRCFVRLPGSYPITQLTLELENRPKYLKGFVERQF 573 Legionella pneumophila str. Lens
AAS58908      525 EMERVTLVSYSDIQSLPDLTCYVTLPGPYPAVKLALKYQERPKVAPEFIPREM 577 Salmonella enterica subsp. enterica serov...
CAH17215      533 QRTKRNTVEEGDIMTLDDMECYVRLVGNHPITRLKNKYIERKEICVPLVERSI 585 Legionella pneumophila str. Paris
cucgc:lpg2078 519 QTKEKQLVLPTQIQVINDLQGYLRVKGEFPAAKIKLNYVDYPLIHEEFIARDI 571 Legionella pneumophila subsp. pneumophila...
CAF24165      516 QTRYQQLITKTDIQFLSRNQAFVRLPDNCPIVRLNV----------PILPR-- 556 Candidatus Protochlamydia amoebophila UWE25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap