Conserved Protein Domain Family
TraX_Ftype

?
TIGR02755: TraX_Ftype 
type-F conjugative transfer system pilin acetylase TraX
TraX is responsible for the acetylation of the F-pilin TraA during conjugative plasmid transfer. The purpose of this acetylation is unclear, but the reported transcriptional regulation of TraX may indicate that it is involved in the process of pilu extension/retraction.
Statistics
?
PSSM-Id: 131802
View PSSM: TIGR02755
Aligned: 3 rows
Threshold Bit Score: 275.226
Threshold Setting Gi: 500818116
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAS58904      23 LLAWSPGQRDLIKTVALLLMVADHINRILHLNQEWLFLAGRGAFPLFALVWGLNLSRHTHIRQSAINRLWGWAVIAQSGY 102 Salmonella ente...
WP_000205710  25 FLVWSPGQRDIIKTVALVLMVLDHINLIFLLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAY 104 Escherichia coli
WP_012000723  24 VLNFSALQRDVIRMVAFVAMVGDHIATAFQLDMPLLNMGGRCAFPLFALVCGCNMAGK-TLRQHSLNRLWLMALLAQPGY 102 Escherichia coli
AAS58904     103 FLA----GFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAALLLLTAWIPLSGTSYGVAGVLVLVICYRLYRITDTEEHL 178 Salmonella ente...
WP_000205710 105 YLA----GFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERL 180 Escherichia coli
WP_012000723 103 WLAfrdvGLAWWQLNILFTFAVVMQVALFLQSATARNGVAAFTVLMGYTPFSSASYGIPGLLMLAGALLVWQVRGT-LRP 181 Escherichia coli
AAS58904     179 ALAACLVVAVPALNLVTSDAAAVAGLLVTGLTV----WLVSLTGKSRPRFWPADFFPVFYTCHLAALGVLAM 246 Salmonella enterica sub...
WP_000205710 181 ALVACLLAVIPALNLATSDAAAVAGLVMTVLTV----GLVSCTGKSLPRFWPGDFFPTFYGCHLAVLGILVL 248 Escherichia coli
WP_012000723 182 ALFAVWLLLVALLNARHGDVMMFSGVILTLTVLfcvhGLVPASGR---RLQAGRWFAPAYAIHLFFIGFLVR 250 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap