Conserved Protein Domain Family
sodN

?
TIGR02753: sodN 
superoxide dismutase, Ni
This superoxide dismutase uses nickel, rather than iron, manganese, copper, or zinc. Its gene is always accompanied by a gene for a required protease.
Statistics
?
PSSM-Id: 131800
View PSSM: TIGR02753
Aligned: 4 rows
Threshold Bit Score: 205.19
Threshold Setting Gi: 12644360
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE19753        1 MLTKLVNSLLNKKSTLEVHAHCDGPCGVYDPASTRVAAEAVLAMTKKLIALNPPSSTDsadwAAYSNTFSRFVAVKEEQA 80  Prochlorococcu...
AAQ00412        1 MLRLAISSLLKRLPAQKALAHCDGPCGVYDPASARISAEAVLSMTKKLLALTPPEGKDssewATYNNTFSRFVAVKEEQA 80  Prochlorococcu...
P80735          1 MLSRLFA------PKVTVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDP------------HFQTRATVIKEQRA 62  Streptomyces c...
tigr:CPS_0444   1 MLYDIIAKFDKKLHFPVVMAHCDIPCKIYDPIGAQISVLTIIRMVDLLNELKAKSSLT----LDEQAEFLRLVNQKENHG 76  Colwellia psyc...
CAE19753       81 KETKKEILILWTDYFKPVHLETYPDLHETIWKAAKLCSACKVNIDLAQAEELMSYVEKIHNIFWESKGR 149 Prochlorococcus marinus s...
AAQ00412       81 QETKKELLILWTDYFKPEHLASFPDLHDTFWKAAKLCSACKVNIDQSKTEELMAAVEKVHHMFWKSKGR 149 Prochlorococcus marinus s...
P80735         63 ELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA 131 Streptomyces coelicolor A...
tigr:CPS_0444  77 IKVKEEISVIWGDYIKAPQLTQFPELHELVHNIMLASSQAKQHISKEAAQILLQQVNRFAEIFWATKKV 145 Colwellia psychrerythraea...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap