Conserved Protein Domain Family
MenG_heptapren

?
TIGR02752: MenG_heptapren 
demethylmenaquinone methyltransferase
MenG is a generic term for a methyltransferase that catalyzes the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 131799
View PSSM: TIGR02752
Aligned: 6 rows
Threshold Bit Score: 474.677
Threshold Setting Gi: 54042286
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9KCC4   3 ETKEERVHQVFEKIYKRYDVMNSVISFQRHKAWRKDTMKRMNVQEGQSALDVCCGTADWAIALGKAVGPTGHVEGLDFSE 82  Bacillus halodurans C...
Q5WGT4   3 QSKEQRVHDVFQSIYKKYDVMNSVISLQQHKSWRKDTMKQMDVQAGTSALDVCCGTGDWTLALSEAVGEQGSVIGLDFSE 82  Bacillus clausii KSM-K16
P31113   3 DSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAGKSGEIKGLDFSE 82  Bacillus subtilis sub...
Q5KXU0   3 QSKEERVHRVFEKISAHYDRMNSVISFRRHLKWREDVMRRMNVQKGKRALDVCCGTADWAIALAEAVGPEGEVYGLDFSE 82  Geobacillus kaustophi...
Q8CWG0   5 SSKEERVHHVFENIYSKYDSMNSIISFQRHKSWRKDTMKRMNVQAGETALDVCCGTGDWSISLSEAVGQTGKVIGLDFSK 84  Oceanobacillus iheyen...
P67055   3 ETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQKGTNVLDVCCGTADWSIMMAEEIGPEGHVTGLDFSE 82  Listeria monocytogene...
Q9KCC4  83 NMLSIGKKKIADERLDHVFLRHGNAMELPYADDTFDFVTIGFGLRNVPDYMQVLREMARVTKPGGKVVCLETSQPTIPVF 162 Bacillus halodurans C...
Q5WGT4  83 NMLAVGREKVAAAKRTNISLVHGNAMALPYDDNTFDYVTIGFGLRNVPDYMQVLQEMCRVAKPGGKIVCLETSQPTIPVF 162 Bacillus clausii KSM-K16
P31113  83 NMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMRRVVKPGGQVVCLETSQPEMFGF 162 Bacillus subtilis sub...
Q5KXU0  83 NMLKVGEQKVKARGLGNVKLIHGNAMQLPFPDNSFDYVTIGFGLRNVPDYMTVLKEMHRVTKPGGMTVCLETSQPTLFGF 162 Geobacillus kaustophi...
Q8CWG0  85 NMLSIAKQKKQDLQLNQLELVHGNAMELPYEENSFDYVTIGFGLRNVPDYMTVLEEMYRVVKPGGKVVCIETSQPTLIGY 164 Oceanobacillus iheyen...
P67055  83 NMLKVGREKVKEADLHNVELIHGNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMYRVLKPGGQLACIDTSQPNIPGW 162 Listeria monocytogene...
Q9KCC4 163 KQLYFFYFRHVMPLFGKMFAKSYDEYSWLQESTLSFPGRDRLAQMFKEVGLTDVQVKPYSGGAAAMHLGVK 233 Bacillus halodurans C-125
Q5WGT4 163 KQLYFFYFKRIMPLAGKVFAKKYEEYSWLQESTLAFPGKDKLRDMFVEAGMKDVTVKSYTGGVCAMHMGIK 233 Bacillus clausii KSM-K16
P31113 163 RQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEEAGLKNVKYHSFTGGVAATHIGWK 233 Bacillus subtilis subsp. subti...
Q5KXU0 163 RQLYYFYFRFIMPLFGKLLAKSYEEYSWLQESAREFPGRDELAEMFREAGFVDVEVKPYTFGVAAMHLGYK 233 Geobacillus kaustophilus HTA426
Q8CWG0 165 RQAYYFYFKFIMPILGKLIAKSYKEYSWLQESAKDFPGKKELKEMFLNAGFDKVEMKSYTGGVAAMHMGFK 235 Oceanobacillus iheyensis HTE831
P67055 163 KQVFNAYFRYVMPVFGKFFAKSYKEYSWLQESTREFPGMARLAEMFQEAGFSYVRYISHSGGASATHFGFK 233 Listeria monocytogenes EGD-e
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap