Conserved Protein Domain Family
PEPCase_arch

?
TIGR02751: PEPCase_arch 
phosphoenolpyruvate carboxylase, archaeal type
This family is the archaeal-type phosphoenolpyruvate carboxylase, although not every host species is archaeal. These sequences bear little resemblance to the bacterial/eukaryotic type. The members from Sulfolobus solfataricus and Methanothermobacter thermautotrophicus were verified experimentally, while the activity is known to be present in a number of other archaea. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131798
View PSSM: TIGR02751
Aligned: 10 rows
Threshold Bit Score: 613.254
Threshold Setting Gi: 19886496
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM32908      7 YPKVMCTQHPDS------ASK---YISTQEEPGEAIEAAVVFGCDEYMPDYEGKATPYHQNVQIVSRFIEETD-LIPGKD 76  Methanosarcina m...
AAK42423      4 IPRTMSTQHPDNakvpewAKSe--VIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTHVVRKLLSNYPDYFReHILGKD 81  Sulfolobus solfa...
AAT43549      6 IPKTMSTQHPDNakmpawASEk-sMIRNDDEVEEAYQCYT-IGIKEVMWDAEGKDVDTHVLRKLISKNHEFFEkNVLGSD 83  Picrophilus torr...
EAM93118      2 IPKTMSTQHPDNalmpewSSNk-nIITNEDEIEEAYIAYKKLGIQEVMWDAEGKDVDTHVIRKLFAKDRIFFEnSKIGQD 80  Ferroplasma acid...
ZP_00869673  11 IPRTMSTQHPDNvhtpffTENi--ELTGEDEVKEAYYVYSHLGCTEQMWDCEGKEVDNYVVKKLLSRYGDYFKeHHLGRD 88  Methanospirillum...
AAG20378      4 VPRLMSTQHPDNatlpffTAGd--VIEGEDEIQEAYYVYSHLGCDEQMWDFEGKEGDEYAVKKLLSRYDEFFAdHQLGTD 81  Halobacterium sp...
AAB89769      2 VPRVMSTQHPDNaripffAASe--VLNGEDEVREAYYVFSHFKCDEQMWDFEGKEADAHIVRKLLSSYYDFFSsRPLGKD 79  Archaeoglobus fu...
BAA29084      8 IPRIMSTQHPDNysipffASSp--ILGGEDEITEAFYAFSVLGADEQMWDFEGKEVDEFVVKKLLERYPTFFKeNILGED 85  Pyrococcus horik...
ZP_00063059   6 IPSIMGTQHPDNanapfwESSqqpFISAYRETGEAFENFNELNVDEYMWDWEGKHADAAVIDRLFSTEYDYFKdHQIGRD 85  Leuconostoc mese...
AAM01407      9 IARTLATQHPD-------ATK---FVRVQEEPEEAVECLVELGAEEYMVDFEGKLTPYLQPIQVLMELYDAG--VRVGEE 76  Methanopyrus kan...
AAM32908     77 IFITPRAPSAAQENR-FRQLMVMMSIAEANHGAL-EYSDVQ------AINEFVHPMTGTVGEILDAQQHMVDVG------ 142 Methanosarcina m...
AAK42423     82 LFLTYRLPNPKVEGAdRKVFAETMESIPITYDLAeKFYGNGit---iPVFEVILPMTTSSLEIISVARYYEKAVanedel 158 Sulfolobus solfa...
AAT43549     84 IFLTYRVPNPAIEGTeRKVLTETLESIPVNYDVFnTVYKRDi----pPIFEVILPFTTSSKDLLNIAKYYEKAVaardei 159 Picrophilus torr...
EAM93118     81 IFLTYRVPNPLIEGAeRKILNETLNSIPLNYDVSnRIFNNGi----aPIFEVILPFTTDYRSMLNVVKFYEKCVvgaqsi 156 Ferroplasma acid...
ZP_00869673  89 LFLTLRVPNPEIERTeAKILLETLGSIPRSYDVAhHFYNDTy----aPIFEIILPMTTSFASIDNIYQYYCDFVigqqyk 164 Methanospirillum...
AAG20378     82 VRLTVRGPNPDVEGSeAKILLEILESIPRSFDAArRFAGEYglettaPIFEVIVPMVTDADQLNAVHEYYERFVtgkade 161 Halobacterium sp...
AAB89769     80 FRLTMRVPNPEIEKGeAKLLAETLEMIPRSYDYVrSLGIEHp-----PIFEVILPMTRSAEEVMKVHAFYRDFVagkgrf 154 Archaeoglobus fu...
BAA29084     86 LRLTPRVPNPSVEKAeAKLLLETLQGITRAADYArVFYLDNi----aPIFEVILPMTTSLAEMLRVHELYRKIVsl--sg 159 Pyrococcus horik...
ZP_00063059  86 KFLTFRFPNIWEEKG-YNLMQAMTAFL-SSEDFAhDLGFSR------PLFEAILPMAQRADQILKMQVLFEKLAn----- 152 Leuconostoc mese...
AAM01407     77 RFVIVRVPSATKENV-LRQVQALLGVMEANSELLkEDPDAR------GIFEVVHPMTSSPEELVETVDRISYAR------ 143 Methanopyrus kan...
AAM32908    143 ELAKK-----EFGVAMEVP--RIIPLIEDAPALLHAKELAENTLLSWEkrfgaaPEKFRVFLGKSDSALSFGHVASTLSC 215 Methanosarcina m...
AAK42423    159 ELYDGvk-vkDLVGEIYPKviEVIPLVEDRDSLQNINNIVEGYYKVIK------PKYMRVFLARSDPAMNYGMITAVLSV 231 Sulfolobus solfa...
AAT43549    160 ELYDNvm-vkNILGETKPKkiNIIPLIEDKDSMFNIDGIVKNFARAVS------AKKMRVFIARSDPAMNYGMIPAVLMS 232 Picrophilus torr...
EAM93118    157 NLYDNvy-srDVTGEVLPGkiNLIPLIEDKDSIFNIEHIVKEYHRVIS------PEYMRIFIARSDPAMNYGMIPATLLA 229 Ferroplasma acid...
ZP_00869673 165 RLGGRdltiaEWIGPFHPDkiRVIPLFEDKDGMLAADTILRRYFQDKD------LDYQRVFLARSDPAVNYGQIGAVLLN 238 Methanospirillum...
AAG20378    162 AVWDGrt-veEWVGEFDPAsiTVIPLIEEREAMLAADDIVREYATAHD------QDAVRVFLARSDPALNYGCLAADLIN 234 Halobacterium sp...
AAB89769    155 ELLGEkv--sDWLGDFLPEeiKVIPLFEDRDSLMRAAEISERYAEWAE------LDELRVFLARSDPAMNYGFVAATIYV 226 Archaeoglobus fu...
BAA29084    160 EVIYDvt-vkEWIGEFYPKeiNVIPLFETKVALLKSGRIIREYIGRKR------PEYLRVFFARSDPAMNYGLLSAVTYV 232 Pyrococcus horik...
ZP_00063059 153 FKSAEf---tR--SDKNTPyiEMIPLFEDFETQLHAPEILKEYLNLHEehfgfrPKYMRVFLAGSDSALTAGFMSSITGN 227 Leuconostoc mese...
AAM01407    144 RFASR-----ELDVPLKAGnlRIIPLIEEVPELLDIRNILTGYVEGMReig-mdVSYLRVFIGRSDPALSYGHLPAVLAC 217 Methanopyrus kan...
AAM32908    216 KYAISGISELDLELDTSTGIIFGAGTLPFRGHLSLKNAENFFREYRGIGTITLQSAVRYSHDKGEAEALVRLAEERLPES 295 Methanosarcina m...
AAK42423    232 KIALSELYKLSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSAISSINNSRISP 311 Sulfolobus solfa...
AAT43549    233 KYAASRLCKMNDDIEN--YPIVGVGSSTFRGRFSPENIEKSLYEYSNYYTFTLQSAFKYDYPQDSVKNSINIINRH-ERS 309 Picrophilus torr...
EAM93118    230 KYAASKMGQISDDTGMSVYPIIGAGSSPFRGNLGPANIKRALSEYDQYYTFSIQSAFRYDYNDQEVKDSIKLINKHTPQK 309 Ferroplasma acid...
ZP_00869673 239 KIALWRLHLLSEDTGIPVYPIIGAGSAPFRGNLRPDTVRRVTDEYAGAYTFTIQSAFKYDTNLEEAVSAIRYLEEREI-T 317 Methanospirillum...
AAG20378    235 KVALQRLYEMSEATGVDVHPILGAGSAPFRGNLTPERAAATADAYSEVETFTVQSAFKYDYPVETVRDGVATLRDADLGA 314 Halobacterium sp...
AAB89769    227 KKALYDLSQL----GISTYPILGVGSCPFRGGFSPKNLS-VLDEFPSVYTFTVQSAFKYDYEFGDVRRAIKRAKEAAR-- 299 Archaeoglobus fu...
BAA29084    233 KKALEQVGEVEEETSTPIYPIIGVGSPPFRGGMRPENVKKVLKEYPSVQTYTIQSSFKYDHPTKDVVKAVEIVKSKKR-- 310 Pyrococcus horik...
ZP_00063059 228 KLAIARLHEFAEEENIEIFPISGTGSAIFRGGLSPHRIDRYVTEFPGVRTATVQSAFRYDFPIEEVQKGIAELKEKLPVA 307 Leuconostoc mese...
AAM01407    218 KLAIFEVYELSDELGVPMAPILGGGCLPFRGHIRPGMEEEFVEEYAGTATYTVQSGFRYDHDREKAVASIRRINELAAND 297 Methanopyrus kan...
AAM32908    296 PEIYSGEEKE-EIVNLIGIFGARYNRIIREMSCTINQLAGLLPQQRDRLMHKGTGGYSRNVPdisglvclcrkd------ 368 Methanosarcina m...
AAK42423    312 ARILEKYEED-VLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKLHIGLFGYSRSAG------------------ 372 Sulfolobus solfa...
AAT43549    310 FDYLEDYEEE-IIKNAVNKYVINYQKIIEKLAPAINNITMYLPKRRSRKLHIGLFGYSRSTG------------------ 370 Picrophilus torr...
EAM93118    310 AEFIDIETEK-IIKGIVGTYSERFQKIIEDIAQPINDITFYLPKRRERKLHIGLFGYSRSTG------------------ 370 Ferroplasma acid...
ZP_00869673 318 PAREIDDTY---AISLIERYAAGYQKQIRSLAPLINRVAAYIPSRRKRKLHVGLFGYSRNMG------------------ 376 Methanospirillum...
AAG20378    315 PPFPIDEAR---ALAVIDRTADAYADQVDAIAGTVNRLSSYVPDRRARKLHVGLFGYAREVG------------------ 373 Halobacterium sp...
AAB89769    300 RKSDYVDEE---HLQVAEKLKDGYRRRIAKIAEIVNRISSRIPRRRMRKLHVGLFGYSRGE------------------- 357 Archaeoglobus fu...
BAA29084    311 --EAPDPLD---IPEFIQLYEIEYQKQLKILAPYIRNIVTRIPDRRKRKLHIGLFGYSRNVG------------------ 367 Pyrococcus horik...
ZP_00063059 308 EPLKISLDDQkILTEIAEESAKFYSNTLDNLVPSMQAIFKAFPKRRDRRQHVGVLGYSRSVD------------------ 369 Leuconostoc mese...
AAM01407    298 PLQLSGDDIE-YLVLATAIFMKHYLSVFFRCIGTLNIVADMIPNTRDRLARKGPVGYARDIPepdrvgaqckdlgdvgre 376 Methanopyrus kan...
AAM32908    369 vgkelsasmpaeDLNLPRAIKFTGALYSIGLPPEFIGTGTaLEEAREKLGEeacerLLKKYFPSLASDLSFASGYLDLNV 448 Methanosarcina m...
AAK42423    373 ------------KVSLPRAISFVGSLYSIGIPPELIGISS-LSNLDEKEWD-----IFKQNYVNFKHDLQTAARFLNWES 434 Sulfolobus solfa...
AAT43549    371 ------------NVTLPRAISFVGAMYSMGLPPEIIGISS-LLNMKDDELD-----IIEKTYINLRSDIMESSSYLNYEV 432 Picrophilus torr...
EAM93118    371 ------------KASLPRAISFVGALYSIGVPPEILGIAS-LSSLPESSQV-----LLKKLYRYMEQDIKASAQYFNYES 432 Ferroplasma acid...
ZP_00869673 377 ------------GVSLPRAITVTAALYSIGIPPEVLGLSA-LT---ENDRE-----FVLENYRYVTEDLSDACRYLNPDS 435 Methanospirillum...
AAG20378    374 ------------ENALPRAIGYTASLYAVGCPPTLLGAHA-LT---DDDAA-----FVREAFPAYFDHLADAARYFNPRC 432 Halobacterium sp...
AAB89769    358 ------------EIKLPRAITFCASLYSIGLPSEIIGIAE-MS---DKDYE-----AVCEVFKNFDGMMESAMSLFNPES 416 Archaeoglobus fu...
BAA29084    368 ------------GLSLPRVIKFTASLYSIGLPPELLGLNE-LS---DNQLD-----SISEYYKNLYDDLEFAMRFFSFKV 426 Pyrococcus horik...
ZP_00063059 370 ------------GIELPRAINFTGSFYSVGVPPEFIGFGRaLKHLDADHLS-----VFVRSYPSMSKDFNELARFVNMDA 432 Leuconostoc mese...
AAM01407    377 lyrelrrmrvekLPELPRAIKFTGACYTVGMPPELIGTGRgLAEIEERLGEdaldaVISRLYPMLREDLQFAVEYTFLET 456 Methanopyrus kan...
AAM32908    449 ASRFLPEACLKEIRKDIEVLRDTFSLKVQPEpSYrILLEMMQPDLLQAGTKGNCMDEEVSQLVCSTLTKMGKIRKALG 526 Methanosarcina maz...
AAK42423    435 FKLIKDIWKISEDTIAKIKEDIDYAESVIGI-KLgGIDYDSRKHILMSSLFLLSFKEKILQESKKYLYEMALIRRSLG 511 Sulfolobus solfata...
AAT43549    433 FDALKDVYKIDQETINMIKADVKYIENNYGI-KS-DLGYERERHNYLSSLMNLAFKNHDFENTRKYILDMALIRKFIG 508 Picrophilus torrid...
EAM93118    433 LDYLKEIWKVSDKTLDMIREDIKYVEDNIGI-PT-ETSYNVQKHNLYTKLLLMAFKNRKFEEVKSYIYELSLLRKFIG 508 Ferroplasma acidar...
ZP_00869673 436 S-------FLPDEIKK---ILPDWIEIDPH-----------SEHRVLSGQIEKAVTACQIDSVQDMIIRAGAIRKFLG 492 Methanospirillum h...
AAG20378    433 T----DVLDLDDDTLA---AAVERVDVTPN-----------SEHRAATDDAIDALQRGDDDALRSAIRRGARERQFLG 492 Halobacterium sp. ...
AAB89769    417 L----KIVDLSMDFER----AKELFGYEPD-----------ERHLEKTNEIIKQIDG----DIKNLVVEAGILRGFLG 471 Archaeoglobus fulg...
BAA29084    427 A----ERVGLRELSEK--VKEFKPDID--------------DEYVREAELVFRGQGD---------VMKLAQIRGFLG 475 Pyrococcus horikos...
ZP_00063059 433 LQILKTQNSAWAEVEEDILIMQRIFKFEIG------PQTREEQQHAEIALQVVQFKDGAPVAITALINRMAQLRHFLG 504 Leuconostoc mesent...
AAM01407    457 AGSVLPSSGVAMVNTDLEYCVEYLDLEPPSDfEYqNLVHTLEPYLRYVVSEG--GVEEVNPFVRDLLLEMGRMRGSLG 532 Methanopyrus kandl...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap