Conserved Protein Domain Family
prenyl_cyano

?
TIGR02749: prenyl_cyano 
solanesyl diphosphate synthase
Members of this family all are from cyanobacteria or plastid-containing eukaryotes. A member from Arabidopsis (where both plastoquinone and ubiquinone contain the C(45) prenyl moiety) was characterized by heterologous expression as a solanesyl diphosphate synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 131796
View PSSM: TIGR02749
Aligned: 6 rows
Threshold Bit Score: 541.262
Threshold Setting Gi: 72001745
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD50025         55 ISLETLFEVVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAglkELTVEHRRLGEIIE 134 thale cress
jgi:PMN12a_0055   2 TTATEILQPVELDLEALLLDLRSLIGAGHPILQAAAEHLFSAGGKRLRPGIVLLISRALTSEK---ELPLKHRKLAQITE 78  Prochlorococ...
P72580            2 ISTTSLFAPVDQDLRLLTDNLKRLVGARHPILGAAAEHLFEAGGKRVRPAIVLLVSRATLLDQ---ELTARHRRLAEITE 78  Synechocysti...
P31171            2 ASITNILAPVENELDLLTKNLKKLVGSGHPILSAASEHLFSASGKRPRPAIVLLISKATMENE---IITSRHRRLAEITE 78  Cyanophora p...
BAC88694          4 VSAANWSALVEDDLSQMTRNLKNLLGTKHPVLYAAAEHLFNAGGKRIRPALVLLVSRATAAYG---EPTERHRRLAEITE 80  Gloeobacter ...
P51268            2 ATSSSLFHPIEKELYSVEHNLKSVAGTRHPILYAAAKHLFEAGGKRLRPAIVLLVAKSTSEQQ---EIKPGQRRLAEITE 78  Porphyra pur...
AAD50025        135 MIHTASLIHDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSLF 214 thale cress
jgi:PMN12a_0055  79 MIHTASLVHDDVVDEADTRRGVETVHSRFDPRIAVLAGDFLFAQASWHLANLENLEVVKLLSRVIMDLAEGEIKQGLNRF 158 Prochlorococ...
P72580           79 MIHTASLVHDDVVDEADLRRNVPTVNSLFDNRVAVLAGDFLFAQSSWYLANLDNLEVVKLLSEVIRDFAEGEILQSINRF 158 Synechocysti...
P31171           79 IIHTASLVHDDILDESDVRRGIPTVHSDFGTKIAILAGDFLFAQSSWYLANLESLEVVKLISKVITDFAEGEIRRGLNQF 158 Cyanophora p...
BAC88694         81 MIHTASLVHDDVIDTSAVRRGIDTVNSRFGNRVAVLAGDYLFGMASAYLARLGSLEVVELLGIVISHFGEGELLQSTLQF 160 Gloeobacter ...
P51268           79 IIHTASLVHDDVIDECSTRRGEKTVHKLFNTKIAVLAGDFLFAQSSWYLANIGNLEVVKVITKVITDFAEGEIRQGLVHF 158 Porphyra pur...
AAD50025        215 DCDVKLDDYMLKSYYKTASLVAASTKGAAIFSKVESKVAEQMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPAANDLAKG 294 thale cress
jgi:PMN12a_0055 159 DSSQSFESYLEKSYCKTASLIANSSKAIGVLSNVDQESLNSLYFFGRQLGLAFQVVDDILDFTGNDEQLGKPAASDLQSG 238 Prochlorococ...
P72580          159 DTDTDLETYLEKSYFKTASLIANSAKAAGVLSDAPRDVCDHLYEYGKHLGLAFQIVDDILDFTSPTEVLGKPAGSDLISG 238 Synechocysti...
P31171          159 KVDLTLEEYLEKSFYKTASLLAASSKAAALLSHVDLTVANDLYNYGRHLGLAFQIVDDILDFTSSTEELGKPSCSDLKKG 238 Cyanophora p...
BAC88694        161 DSDLTFEQYIDKSFYKTASLMAGTSRAAAVLSESPAAVCEALYEYGRHLGIAFQVIDDLLDFTGSTAKLGKPAGSDLRDG 240 Gloeobacter ...
P51268          159 DPSISIDDYIEKSFYKTASLVAASCRGAAMLNDLNSQMHNDLYLYGKHMGLAFQIMDDVLDIAGSTKSLGKPSGADFMNG 238 Porphyra pur...
AAD50025        295 NITAPVIFALENEPRLREIIESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCLPRSGFRSALEDMVMFN 374 thale cress
jgi:PMN12a_0055 239 YLTAPVFYALEENPSLSELINGKFSQKDDLDQALSLVRDSSAIKKSRELAEQFASESKDSISWLPDSPSKKALLELPEFV 318 Prochlorococ...
P72580          239 NITAPALFAMEKYPLLGKLIEREFAQAGDLEQALELVEQGDGIRRSRELAANQAQLARQHLSVLEMSAPRESLLELVDYV 318 Synechocysti...
P31171          239 NLTAPVLFALEQNSELIPLIQRQFSEPKDFEYTLQIVEETKAIEKTRELAMEHAQVAIQCLENLPPSSSKEALKLITKYV 318 Cyanophora p...
BAC88694        241 NLTAPVLYALEESPHLSGLIERQFEQKGDLEKALSLIHASRALERTRELAETHARRAVTSLDTLSPSPAREALKDLVGHT 320 Gloeobacter ...
P51268          239 NLTAPILFALTQEGKLDQLIQREFSDERDISLALFLIKKSGGITKAKDLAKEQVQAALCCLQFLPKSAPVSSLKELTHFI 318 Porphyra pur...
AAD50025        375 LERID 379 thale cress
jgi:PMN12a_0055 319 ISRLY 323 Prochlorococcus marinus str. NATL2A
P72580          319 LGRLH 323 Synechocystis sp. PCC 6803 substr. Kazusa
P31171          319 LERLY 323 Cyanophora paradoxa
BAC88694        321 VSRLY 325 Gloeobacter violaceus PCC 7421
P51268          319 ITRLS 323 Porphyra purpurea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap