Conserved Protein Domain Family
GerC3_HepT

?
TIGR02748: GerC3_HepT 
heptaprenyl diphosphate synthase component II
Members of this family are component II of the heterodimeric heptaprenyl diphosphate synthase. The trusted cutoff was set such that all members identified are encoded near to a recognizable gene for component I (in pfam07307). This enzyme acts in menaquinone-7 isoprenoid side chain biosynthesis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 131795
View PSSM: TIGR02748
Aligned: 7 rows
Threshold Bit Score: 558.18
Threshold Setting Gi: 46881433
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB05372   2 KLADIYAHFQEDIFTIERELEEAVQ-ARHDILRKASVHLLKAGGKRIRPVFVLLAGKFG-TYDVNVLKHIAVPLELIHMA 79  Bacillus halodurans...
BAD64424   2 KLADIYKAFQGDIEFIEAELERTLS-AKHPVLKEASTGLLKAGGKRIRPVLVLLAGKFG-DYQLDRLKHIAVTLELIHMG 79  Bacillus clausii KS...
P55785     2 KLKAMYSFLSDDLAAVEEELERAVQ-SEYGPLGEAALHLLQAGGKRIRPVFVLLAARFG-QYDLERMKHVAVALELIHMA 79  Geobacillus stearot...
P31114    30 KFKMAYSFLNDDIDVIERELEQTVR-SDYPLLSEAGLHLLQAGGKRIRPVFVLLSGMFG-DYDINKIKYVAVTLEMIHMA 107 Bacillus subtilis s...
AAT63220   5 KLQLMYSFLRSDINVIEKELKKTVA-SEQPLVEEAALQLIEAGGKRIRPVFVLLAGKFG-DYKLDAIKHVAVALELIHMA 82  Bacillus thuringien...
BAC13744   2 KLPKIYGFLKKDMESIESALQDSIQ-ANHPVLRDASTELLHAGGKRIRPVFVLLSSQLG-NYDLSKIKKVAVTLELIHMA 79  Oceanobacillus ihey...
AAT04729   2 KLNFLYANMQKDIDSVEKELKKALSgAAAETTSDAALHLLEAGGKRIRPMFVCLSARLApNADFDAVKNASVAIELIHMA 81  Listeria monocytoge...
BAB05372  80 SLVHDDVIDDADLRRGKKTIKSQWDNRIAMYTGDYMFAKAVQTATYFDDPNIHQIISNAINEMCLGEVEQIRDQYNPNQH 159 Bacillus halodurans...
BAD64424  80 SLVHDDVIDNAPLRRGRETVMSRWDNRVAMYTGDYIFGHAIETTKAFSDKRVHTIISDVMNQICRGEIEQIRDQYNWDQG 159 Bacillus clausii KS...
P55785    80 SLVHDDVIDDADLRRGRPTIKAKWSNRFAMYTGDYLFARSLERMAELGNPRAHQVLAKTIVEVCRGEIEQIKDKYRFDQP 159 Geobacillus stearot...
P31114   108 SLVHDDVIDDAELRRGKPTIKAKWDNRIAMYTGDYMLAGSLEMMTRINEPKAHRILSQTIVEVCLGEIEQIKDKYNMEQN 187 Bacillus subtilis s...
AAT63220  83 SLVHDDVIDAAFLRRGSATVNAKWGDRIAMYTGDYLFAKSLECITNIEIPEAHQALSHTILEVCKGEIEQIKDKYNYDQN 162 Bacillus thuringien...
BAC13744  80 TLVHDDVIDEAELRRGKPTTASIYGNRVAMYTGDYILARALEEITEIPDPRVHQLLSKTLVEVSIGEIEQIEYKFNWEQN 159 Oceanobacillus ihey...
AAT04729  82 SIVHDDVVDNADLRRGRETIKSKWGNHIAMYTGDFLFAKSLEYMTEIKDVAAHKMLSHVTVELSTGEIEQLKDKYNFDQS 161 Listeria monocytoge...
BAB05372 160 LRIYFRRIKRKTALLIAVSCQLGALAAKADPAIVQKLYYFGYYVGMSFQITDDVLDFVGTEEQLGKPAGSDLLQGNVTLP 239 Bacillus halodurans...
BAD64424 160 LRIYLRRIKRKTALLIAVSCQLGAIVSGATDELQKNLYYFAYFLGMSYQIMDDILDFVGTNEQLGKPAGGDLRQGNVTLP 239 Bacillus clausii KS...
P55785   160 LRTYLRRIRRKTALLIAASCQLGALAAGAPEPIVKRLYWFGHYVGMSFQITDDILDFTGTEEQLGKPAGSDLLQGNVTLP 239 Geobacillus stearot...
P31114   188 LRTYLRRIKRKTALLIAVSCQLGAIASGADEKIHKALYWFGYYVGMSYQIIDDILDFTSTEEELGKPVGGDLLQGNVTLP 267 Bacillus subtilis s...
AAT63220 163 LRTYLRRIKRKTALLIAASCQLGAIAAGANRDTVSRLFWYGYFVGMSYQIIDDILDFVSTEEKLGKPAGGDLLQGNITLP 242 Bacillus thuringien...
BAC13744 160 FRDYLRRIKRKTALLIASSCKLGAIVGGLNDYQTNKLYQYGYYIGMSYQIIDDILDFTSTSKELGKPAGNDLLQGNITLP 239 Oceanobacillus ihey...
AAT04729 162 VRNYLRRIKRKTALLIAASCGLGGVVSGQSEADYQKLYRFGYYVGMAFQITDDVLDFVGTEKELGKPAGEDLRQGNVTLP 241 Listeria monocytoge...
BAB05372 240 ALYALHHDMhAKRLIEQVLADRg-nNSVHMEEVIAAIVSSGGIDYALSISDLYLKKAMRMLDHLPDDEPKQFLQEIANYI 318 Bacillus halodurans...
BAD64424 240 ALYAIEHTPgFKQRLEKSLTKEs-sLEMDMEPLLNEVRTSGGIEYAQAMSDRYLHKANTLLMGFPDIDAKRHLIEVASYI 318 Bacillus clausii KS...
P55785   240 VLYALSDER-VKAAIAAVGPET---DVAEMAAVISAIKRTDAIERSYALSDRYLDKALHLLDGLPMNEARGLLRDLALYI 315 Geobacillus stearot...
P31114   268 VLYALKNPA-LKNQLKLINSET---TQEQLEPIIEEIKKTDAIEASMAVSEMYLQKAFQKLNTLPRGRARSSLAAIAKYI 343 Bacillus subtilis s...
AAT63220 243 ALYAMEDPI-LCKKIRSVHENT---TADEMKEIIEAVKNSAAIDKAFAFSERYLHKALEMIKPLPRGQAKYALQNVAKYI 318 Bacillus thuringien...
BAC13744 240 VLYAMEDKT-FKQSLFNVFSKDghvTTNEMKTLIQHLKRTDAIKRSYAVSDMYLSKALTALDEIPASRAKKTLQDIATYI 318 Oceanobacillus ihey...
AAT04729 242 VFFAMEDPF-LKKRISQVTEET---PAEEIAVLVEEVKKA-GAKQAEDVATVYLKKAVEILDSLPQVPELKPLKQIVRVL 316 Listeria monocytoge...
BAB05372 319 GRRKF 323 Bacillus halodurans C-125
BAD64424 319 GRRKY 323 Bacillus clausii KSM-K16
P55785   316 GKRDY 320 Geobacillus stearothermophilus
P31114   344 GKRKF 348 Bacillus subtilis subsp. subtilis str. 168
AAT63220 319 GKRKF 323 Bacillus thuringiensis serovar konkukian str. 97-27
BAC13744 319 GKRRS 323 Oceanobacillus iheyensis HTE831
AAT04729 317 DKRNY 321 Listeria monocytogenes serotype 4b str. F2365
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap