Conserved Protein Domain Family
TraQ

?
TIGR02741: TraQ 
type-F conjugative transfer system pilin chaperone TraQ
This protein makes a specific interaction with the pilin (TraA) protein to aid its transfer through the inner membrane during the process of F-type conjugative pilus assembly.
Statistics
?
PSSM-Id: 131788
View PSSM: TIGR02741
Aligned: 3 rows
Threshold Bit Score: 131.549
Threshold Setting Gi: 52538083
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG27509      31 MRKFRFRLPEFDVPGLWVLSLGIWFHIVSRLVRREPEMAILLAQIIGVSMVLWGGYRIINRWIdaAREAEKARDAGGCRH 110 Yersinia pestis
AAY88107       1 MRKYKLSLPLPDITGSMGFLPGRLVHIVGRLVYRKPWMAFFLAELIAVILVLSGAYRVLDAWI--ARVSREERALLEARQ 78  Salmonella ente...
WP_000624108   2 ISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWI--ARVSREEREALEARQ 79  Escherichia coli
CAG27509     111 EP 112 Yersinia pestis
AAY88107      79 TA 80  Salmonella enterica
WP_000624108  80 QA 81  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap