Conserved Protein Domain Family
TrbB

?
TIGR02738: TrbB 
type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB
This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Statistics
?
PSSM-Id: 131785
View PSSM: TIGR02738
Aligned: 9 rows
Threshold Bit Score: 141.095
Threshold Setting Gi: 52629406
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG27510        20 LRHIVFTVALMTLSLaTQASTMDEIKSLWHPqgaras--------gslptsPEDPEVKPLPAKQpvwyrlsnGRQINLAD 91  Yersinia pestis
CAH17346         2 FARVFLIVMLAFIGLgAKAEGSQWLTNLIAE--------------------QEGLVTHQREEPQn------tKRKGFFST 55  Legionella pn...
CAH17212         2 KKRFFLIVLFLLSTQsFANVALDELTQLLDKk------------------qEQQVLARTKNKRI----------NALSEQ 53  Legionella pn...
cucgc:lpg2081    1 MRNKLAIFLILGTLF------------------------------------SSSLYADIDNAPL----------HALAKH 34  Legionella pn...
AAW58914         2 SLIKSLLFTLLLAAAaVQASTRDEIERLWNPqgmaa-----------qpaqPAAGTSARTEKPAprwfrlsnGRQVNLAD 70  Escherichia coli
AAM90721         5 ALRTAILMAAMLAGC-LQAGTLDDIRALEAGktgrsapamdalslpenratPTTDRAAQDTSPVwyt--lsdGRKVNLQD 81  Salmonella en...
CAG17953         1 MYRLLIVTLSLVLCW------------------------------------MQPVTASTDNQP-----------HFKQDD 33  Photobacteriu...
CMCP6:VV2_0647   2 LKRALFCLLFITTAS-----------------------------------------------PT---------YAVMQDQ 25  Vibrio vulnif...
BAC97741         3 FLRTLLLSFSLFAGS---------------------------------------------------------AHAAMQNQ 25  Vibrio vulnif...
CAG27510        92 WKVVLFMQGHCPYCHQFDPVLKSLSARVGFGVMAYTIDGQGDASFPDALPAPPEVMKTFFPN---LPVATPTTFLVNVNT 168 Yersinia pestis
CAH17346        56 HGLILFYGSQCPHCKRFAPILKGWANRNKAEVLPLSLDNQPLPEFPKFLPATTEWINAAFGG---NSINYPALFVVNPKT 132 Legionella pn...
CAH17212        54 HYFIFIYRSTCPHCHQFAPILRDFASSFHIPVEAYSLDGESLDGF-DSANLTPELFQTLYVSgeyKPVV-PALYLVNRPT 131 Legionella pn...
cucgc:lpg2081   35 QGFFFFFSSSCPHCQRFAPTLKRLSQHYGFSVVAISVDGGFLPSFPDAV--MNEGQTKVF-----QVSVYPSLFLINPKS 107 Legionella pn...
AAW58914        71 WKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSVFPYTLDGQGDTAFPEALPVPPDVMQTFFPN---IPVATPTTFLVNVNT 147 Escherichia coli
AAM90721        82 WKVVLFMQSTCQYCRQFAPVLKAFSQQTGLDVFPISLDGKGDAEFPDVLPATPDVMVEYFQSg--LPVATPTTFLTNVNT 159 Salmonella en...
CAG17953        34 YALVFFFRSDCSYCHLFAPTLKQFEQQTGLTTYAFSLDNKGMTGFEVPIPVTKEIAETFFDNp--RSITVPATFLINVNS 111 Photobacteriu...
CMCP6:VV2_0647  26 YAMVFFYRSDCPYCHKFAAKFKTFTQQAQLQTYVFSLDNRPITEYPVPIPATPELSQLFFENp--RNITVPATFLINVNS 103 Vibrio vulnif...
BAC97741        26 YALVFFFQSTCPYCHKASPKITRLSERFELPVYAFSVDGVGIAGFEVPIPVTPEIGRTFFPGn--AKAVMPALFLMNVNS 103 Vibrio vulnif...
CAG27510       169 LEALPLLQGATDEQGFMARMDTVL 192 Yersinia pestis
CAH17346       133 KTLYPVGFGSMTNAELNDRMAVLI 156 Legionella pneumophila str. Lens
CAH17212       132 NQAYAVLFGEAEPAQLANRVDELM 155 Legionella pneumophila str. Paris
cucgc:lpg2081  108 QVASLVTEGTIDEGELTNRLLKIS 131 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
AAW58914       148 LEALPLLQGATDAAGFMARMDTVL 171 Escherichia coli
AAM90721       160 METWPLLQGAAETGEFRSRLDEVL 183 Salmonella enterica subsp. enterica serovar Typhi
CAG17953       112 RKFARMAQGQVSLHDLQTTYSQIR 135 Photobacterium profundum SS9
CMCP6:VV2_0647 104 RKFVKVSIGDVTYDELEQSVKGIL 127 Vibrio vulnificus CMCP6
BAC97741       104 RKFSRLSIGDVPESTLAQSIQNAL 127 Vibrio vulnificus YJ016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap