Conserved Protein Domain Family
caa3_CtaG

?
TIGR02737: caa3_CtaG 
cytochrome c oxidase assembly factor CtaG
Members of this family are the CtaG protein required for assembly of active cytochrome c oxidase of the caa3 type, as in Bacillus subtilis.
Statistics
?
PSSM-Id: 131784
View PSSM: TIGR02737
Aligned: 5 rows
Threshold Bit Score: 409.502
Threshold Setting Gi: 22777123
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB06624         4 LFSNFGFRALWTPELIIILAMVGFVYFMIatkWRERFTNSEPVPIRKKIYFVLGLIALYIGWGSPFYVAGHLMITFHMAQ 83  Bacillus halo...
O34329           3 QLEIFGFRAMWSPYLFCILLGITALYLYF---YRRMSSKPNRITGKEMVCFLSAMLFLYAAEGSPVDLLGHIMFSAHMVQ 79  Bacillus subt...
BAD75371         4 SLQMFGPVALWSPFFLLMLAAVALLYIGItgpWRQRFGLGDAVSEKQKAYFLTGIALLYICKGSPLDLMGHLTFTAHMVQ 83  Geobacillus k...
tigr:GBAA_4150   3 NLWIFGFQALWSPIFLLFMLSILIGYFLIigpYRMRFEHATKVSKKQVFYFTTGIVLLYFVKGGPIDLIGHIIFSAHMFE 82  Bacillus anth...
BAC13397         4 DIQIFGFRALWSPYFLIFVILLGTAYYLItgpLRREFGDNDKPTAKQQSMFYIALLLLYFVKGAPIDLLSHITLTAHMIQ 83  Oceanobacillu...
BAB06624        84 MVFAYFIAVPLFLLGTPAWVFSAIFEklrRPWSEQFAKIAMNPIVALLLFNGLFSLYHVPFMFDSLMQSPILHSLYQFLL 163 Bacillus halo...
O34329          80 MAVLYLVVPPLLIAGIPAWLWEKIIF---RPSIKPVFSFFTTPLIALLLFNGIFSLYHVPLIFDTVKTDPFYHTLITWLI 156 Bacillus subt...
BAD75371        84 MAVLYLIVPQCFILGIPAPLYERAFR---ITAVRRVFRLLTKPIVALLLFNGLFSLYHVPFIFDAVKMNMWLHAFVTSVI 160 Geobacillus k...
tigr:GBAA_4150  83 MAVMYIAVPPLLLLGIPVWLYRYITS---FKFVQIILKVFARPLIALFVFNGLFSFYHLPVVFDTVKQSQIAHPICLAIL 159 Bacillus anth...
BAC13397        84 MAIYLLVFPMLMIKGIPAWIWEKLMA---TPFVGAVLKFLTKPLISLLLFNGLFSIYHIPAVFNFAKSAPMIHTGISIVL 160 Oceanobacillu...
BAB06624       164 LYGAFLMWWHMIAPIPSTSKLSDLRRIGYIFANGILITPACALIIFAPQPLYQTYTNPAIWAEVMAYCLPPGSSVPLSv- 242 Bacillus halo...
O34329         157 FVLAFFMWWPLVHKVERLRQLSGLMKLGYIMADGMLLTPACALIMFSGAPLYATYTDPALWAEAMRLCVPADMMGQVP-- 234 Bacillus subt...
BAD75371       161 FVAAFCMWWPLVNKLPDWQTLSGLKKMGYIFADGMLLTPACALIIFTDTPLYATYTDPKAWMAALALCVPQGTLASLD-- 238 Geobacillus k...
tigr:GBAA_4150 160 FFTAIMMWWPMLNPLPEYQTLSDIKKLGYMFANGILLTPACALIIFATAPLFATYTDSAAWMKAMELCVPAGTLSDLN-- 237 Bacillus anth...
BAC13397       161 LIAAFIVWIPLLAPIKELDKLQPLLKIGYIFANSVLITPACVLIIFASEPLYATYSQGGAWLQALSLCVPQDVLQGLApq 240 Oceanobacillu...
BAB06624       243 FNGPDSFTFLETRMDQQLAGVLMKIMQEITYGFTIGYVFKQWLSKE 288 Bacillus halodurans C-125
O34329         235 LTGPEMLNTLPLLEDQQLGAVMMKIIQEIVYGTFLAVIFFQWVKKE 280 Bacillus subtilis subsp. subtilis str. 168
BAD75371       239 LTGPQMFLSMSPLHDQQLGGVLMKIIQEIVYGTMLFFIFTEWYRKE 284 Geobacillus kaustophilus HTA426
tigr:GBAA_4150 238 ITGPEFLHWMPVVQDQQTGGIIMKIVQEIVYGTIIGYVFFRWARRE 283 Bacillus anthracis str. 'Ames Ancestor'
BAC13397       241 LSGPETFISLSTVYDQQLGGIIMKIMQEITYGILLGSIIFSWFKGE 286 Oceanobacillus iheyensis HTE831
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap