Conserved Protein Domain Family

TIGR02737: caa3_CtaG 
cytochrome c oxidase assembly factor CtaG
Members of this family are the CtaG protein required for assembly of active cytochrome c oxidase of the caa3 type, as in Bacillus subtilis.
PSSM-Id: 131784
Aligned: 5 rows
Threshold Bit Score: 409.502
Threshold Setting Gi: 22777123
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O34329         235 LTGPEMLNTLPLLEDQQLGAVMMKIIQEIVYGTFLAVIFFQWVKKE 280 Bacillus subtilis subsp. subtilis str. 168
tigr:GBAA_4150 238 ITGPEFLHWMPVVQDQQTGGIIMKIVQEIVYGTIIGYVFFRWARRE 283 Bacillus anthracis str. 'Ames Ancestor'
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap