Conserved Protein Domain Family
cbb3_Q_epsi

?
TIGR02736: cbb3_Q_epsi 
cytochrome c oxidase, cbb3-type, CcoQ subunit, epsilon-Proteobacterial
Members of this protein family are restricted to the epsilon branch of the Proteobacteria. All members are found in operons containing the other three structural subunits of the cbb3 type of cytochrome c oxidase. These small proteins show remote sequence similarity to the CcoQ subunit in other cytochrome c oxidase systems, so this family is assumed to represent the epsilonproteobacterial variant of CcoQ. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131783
View PSSM: TIGR02736
Aligned: 4 rows
Threshold Bit Score: 85.9673
Threshold Setting Gi: 2313239
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD07222  9 GFAYAFFTILFTLFLYAYIFSMYRKQKKGIMDYERYGYLALNDALEDELIEPRHKK 64  Helicobacter pylori 26695
CAE09342 11 AYAYWFFSLALVIFLCGYIFHIYRSQIKGTRDYEKYGRLALDDELTDSLVEAREEK 66  Wolinella succinogenes
AAP77855 16 KEIYLAVTLLLVVFLYGYVYHLYSSQAKGVKDYEKYANLALNDNLDDEPIEPRIKN 71  Helicobacter hepaticus ATCC 51449
CAB73910 32 GYGFFALVMFLSIVLYAYWYHLYRTEKKGERNYENYANLALKDDIDDSVLESKRSA 87  Campylobacter jejuni subsp. jejuni NCTC 11168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap