Conserved Protein Domain Family
purC_vibrio

?
TIGR02735: purC_vibrio 
phosphoribosylaminoimidazole-succinocarboxamide synthase, Vibrio type
Members of this protein family appear to represent a novel form of phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase), significantly different in sequence and gap pattern from a form (see TIGR00081) shared by a broad range of bacteria and eukaryotes. Members of this family are found within the gammaproteobacteria in the genera Vibrio, Shewanella, and Colwellia, and also (reported as a fragment) in the primitive eukarote Guillardia theta. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 131782
View PSSM: TIGR02735
Aligned: 3 rows
Threshold Bit Score: 730.939
Threshold Setting Gi: 40063125
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9KSR6                  2 SLADQVLAVNDDLPIRTHQPVHSGKVRSVYWLTEQDSRRLIKEKGYPVAEDAPLAIMVISDRISAFDCIWHAEGGVHGVP 81  Vibrio...
CAG19880                2 SLADQVLAVNDDLPIRTDKPVHSGKVRSVYWLTEADSRRLIEEKGYNVAPDAPLAIMVISDRISAFDCIWHGEGGMKGVP 81  Photob...
tigr:EBAC000-47H08.51   1 -MSAQFLERNDDFNVPTDEAVHSGKVRSVYWLKPEDSRRLIEKRNYPVSHDAELAILIVSDRLSAFDCIWRAEGGLNGVP 79  uncult...
Q9KSR6                 82 GKGAALNAISNHWFKLFKQHGLAESHILDIPHPFVWIVQKARPIKIEAICRQYITGSMWRAYAKGEREFCGITLPEGLEK 161 Vibrio...
CAG19880               82 GKGAALNAISNHWFKLFRDNDLAESHILDIPHPFIWIVQKAKPVMIEAICRQYITGSMWRSYSKGERDFCGIEVPEGLNK 161 Photob...
tigr:EBAC000-47H08.51  80 GKGAALNAVSLEWFNAFAEAGLARSHILEAPHPLVWVVQRAKPVKIEAIARQYITGSLWRAYAKGERVFCGNDLPNHLAE 159 uncult...
Q9KSR6                162 DSQLPELLMTPSTKGILRGIPGVPEADDVNISRQDIEANYAAFNFNQPQDIDHYETLLKQGFAVISEALKSVGQLFVDTK 241 Vibrio...
CAG19880              162 DQKLPELLITPSTKGILEGIPGVPAVDDVNITRKNIEENFEAFNFRNTDDINHYEKLLQEGFDVISSELEKLDQIFVDTK 241 Photob...
tigr:EBAC000-47H08.51 160 NQRLGEVLITPSSKGVLEGLEGIAAIDDVNITRADIERHWSQLGFEQPEDIDHYERLLREGFAVIADRLSKLGQLFVDTK 239 uncult...
Q9KSR6                242 FEFGYVADQQGQQKLIYMDEVGTPDSSRIWDAQQYQQGKIVENSKEGFRQFLLNYFPDPDILLNKDRMPEREALARDNAL 321 Vibrio...
CAG19880              242 FEFGYVTDASGKEKLIYMDEVGTPDSSRIWDAAAYRDGKIVENSKEDFRQLLLNHFPDPDILLNKDRMEERSALARDNAL 321 Photob...
tigr:EBAC000-47H08.51 240 FEFGYATGVEGTRELIYMDEVGTPDSSRIWNAGAYAQGTVLENSKEGFRQALMNWVPDRNLLLDKHRMVERAAFAGSTLL 319 uncult...
Q9KSR6                322 PLEALMDISRTYLGIAEKITGQPIHLSHQPKQEIIAILDKEYGLI 366 Vibrio cholerae O1 biovar El Tor str. N16961
CAG19880              322 PEEVLMQVSKIYTDIAEKITGKKIVLSKNPKAEITAILRDQYGLV 366 Photobacterium profundum SS9
tigr:EBAC000-47H08.51 320 PQSMLLDVSETYLGIAAQIIGSSITVPENPRAEIKELLSVELGLV 364 uncultured marine bacterium 561
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap