Conserved Protein Domain Family
zeta_caro_desat

?
TIGR02732: zeta_caro_desat 
9,9'-di-cis-zeta-carotene desaturase
Carotene 7,8-desaturase, also called zeta-carotene desaturase, catalyzes multiple steps in the pathway from geranylgeranyl-PP to all-trans-lycopene in plants and cyanobacteria. A similar enzyme and pathway is found in the green sulfur bacterium Chlorobium tepidum.
Statistics
?
PSSM-Id: 131779
View PSSM: TIGR02732
Aligned: 5 rows
Threshold Bit Score: 970.851
Threshold Setting Gi: 33633617
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9SE20    81 KVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKE 160 tomato
AAP99182   2 QVAIVGAGLAGLSAAVDLVDAGHKVDLYEARPFLGGKVGSWEDNEGNHIEMGLHVFFFNYANLFALMDKVGAIDNLLAKE 81  Prochlorococcus mar...
CAE18574   2 KIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYNYANLFKLMKKVGALDNLLPKE 81  Prochlorococcus mar...
Q9R6X4     2 RVAIVGAGLAGLATAIDLADAGCEVQIFESRPFVGGKVGSWIDGDGNHVEMGLHVFFGCYYQLFELMNKVGAFSHLRLKE 81  Nostoc sp. PCC 7120
P74306     2 RVAIVGAGLAGMATAVELVDAGHEVELYEARSFIGGKVGSWVDGDGNHIEMGLHVFFGCYYNLFNLMEKVGAKQNLRLKE 81  Synechocystis sp. P...
Q9SE20   161 HTHTFVNKGGEIGELDFRFPVGAPLHGINAFLSTNQLKIYDKARNAVALALSPVVRALVDPDGALQQIRDLDNVSFSEWF 240 tomato
AAP99182  82 HTHLFVNKGGDVKSLDFRFAIGAPFNGLKAFFTTPQLNWVDKLRNALALGTSPIVQGLIDYDGAMKTIRALDSISFQKWF 161 Prochlorococcus mar...
CAE18574  82 HTHLFVNKGGDLKSLDFRFALGAPFNGLKAFFTTEQLTWVDKLRNALALGTSPIVRGLVDYEGAMKIIRDLDKISFKEWF 161 Prochlorococcus mar...
Q9R6X4    82 HTHTFVNKGGRTGALDFRFFTGAPFNGLKAFFTTSQLSLQDKLQNAIALGTSPIVRGLVDFEGAMKTIRNLDKISFADWF 161 Nostoc sp. PCC 7120
P74306    82 HTHTFVNQGGRIGELDFRFLTGAPFNGLKAFFTTSQLDTKDKIANSIALATSPIVRGLVDFDGAMKTIRDLDRISFAEWF 161 Synechocystis sp. P...
Q9SE20   241 LSKGGTRASIQRMWDPVAYALGFIDCDNMSARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIKKYIMDKGGRFHLRW 320 tomato
AAP99182 162 LSHGGSLNSIKRMWNPIAYALGFIDCEAISARCMLTIFMMFAAKTEASKLNLLKGSPHKWLTKPILEYIEARGGRLHLRH 241 Prochlorococcus mar...
CAE18574 162 LNHGGSLRSLERMWDPIAYALGFINCQDISARCMLTIFMMFASKTEASKLNLLKGSPHKWLTKPIVDYITKKGCKIHLNH 241 Prochlorococcus mar...
Q9R6X4   162 RSHGGSNGSIKRMWNPIAYALGFIDCENISARCMLTIFQFFAVRSEASVLRMLEGSPDEYLHQPILRYLEARGTKVYTRR 241 Nostoc sp. PCC 7120
P74306   162 LSKGGNEGSLKKMWDPIAYALGFIDTENISARCMLTIFQLFAARTEASVLRMLEGSPQEYLHKPIQEYLEQRGTKFYTRH 241 Synechocystis sp. P...
Q9SE20   321 GCREVLYeTSSDGSMyVSGLAMSKATQKKIVKADAYVAACDVPGIKRLVPQKWR-ELEFFDNIYKLVGVPVVTVQLRYNG 399 tomato
AAP99182 242 KVKELRF-KSIDNPE-VTEMIMNSPEGEKVIKADKYLAACDVPGIQNLLPKEWR-IFPEFAAIDKLEAVPVATVQLRYDG 318 Prochlorococcus mar...
CAE18574 242 KVDEIIFeKESSSYS-VTQLKISTPEGPKVIFADTFLAACDVPGIKKIVPKEWY-QFKEFEGLKKLRAVAVATIQLRYDG 319 Prochlorococcus mar...
Q9R6X4   242 QVREIKYaEA-EGQTrVTGIVVAKGDEVEEITADAYVCACDIPGIQRVLPQEWR-KWSEFDNIYKLDAVPVATVQMRFDG 319 Nostoc sp. PCC 7120
P74306   242 KVKEIKTkVT-DGETrVTGLIINDGVETKTVTADAYVAACDVPGIKNLLPENWRtQWDFFNKIYYLDTVPVATVQLRFDG 320 Synechocystis sp. P...
Q9SE20   400 WVTELQDLERSRQLKRAAGLDNLLYTPDADFSCFADLALASPDDYYIEGQGSLLQCVLTPGDPYMPLSNDEIIKRVTKQV 479 tomato
AAP99182 319 WVTELKNQAAQKDLETPSGLDNLLYTADADFSCFADLALTSPEDYQKKGLGSLLQCVLTPGDPWIPKSTEEIVAHTDLQV 398 Prochlorococcus mar...
CAE18574 320 WVTELNN---DNKSQNPTGLDNLLYSADASFSCFADLALASPVDYRKEGMGSLLQCVLTPGDRWMGRSTERITKEIDSEV 396 Prochlorococcus mar...
Q9R6X4   320 WVTELQDENKRKQLKEAAGLDNLLYTADADFSCFADLALTSPSDYYRQGQGSLLQLVLTPGDPFIKESNEAIAQHVLKQV 399 Nostoc sp. PCC 7120
P74306   321 WVTEMNDPAKRKQLEQAFGLDNLLYTSDAEFSCFADLALTSPADYYRPGEGSLLQLVLTPGDPFMKESNEAIAYRVLKQV 400 Synechocystis sp. P...
Q9SE20   480 LALFPSSQGLEVTWSSVLKIGQSLYREGPGKDPFRPDQKTPVENFFLAGSYTKQDYIDSMEGATLSGRQASAYIC 554 tomato
AAP99182 399 RDLFPSAKNLKLIWSNVVKLTQSLYREAPGMEPFRPNQSTPVSNFFLAGSFTQQDYIDSMEGATMSGHLAASAML 473 Prochlorococcus marinus ...
CAE18574 397 RRLFPSSKNLKLLWSNVVQVPQSLYRESPGMDPYRPDQKTSISNFFMAGSYTKQDYIDSMEGATMSGHLAAAAIL 471 Prochlorococcus marinus ...
Q9R6X4   400 YELFPSSRELNMTWYSVVKLAQSLYREAPGMDVYRPNQKTPIANFFLAGSYTQQDYIDSMEGATVSGRRAAKVIL 474 Nostoc sp. PCC 7120
P74306   401 KALFPSAADLNMTWYSVIKLAQSLYREAPGMDLFRPSQATPIANFFLAGSYTQQDYIDSMEGATLSGRQAAQAIL 475 Synechocystis sp. PCC 68...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap