Conserved Protein Domain Family
phytoene_desat

?
TIGR02731: phytoene_desat 
phytoene desaturase
Plants and cyanobacteria (and, supposedly, Chlorobium tepidum) have a conserved pathway from two molecules geranylgeranyl-PP to one of all-trans-lycopene. Members of this family are the enzyme pytoene desaturase (also called phytoene dehydrogenase). This model does not include the region of the chloroplast transit peptide in plants. A closely related family, excluded by this model, is zeta-carotene desaturase, another enzyme in the same pathway. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131778
View PSSM: TIGR02731
Aligned: 5 rows
Threshold Bit Score: 915.773
Threshold Setting Gi: 1345838
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB73531   2 RVAIAGAGLAGLSCAKYLTDAGHTPIVLERRDVLGGLVAAWKDSDGDWYETGLHAFFGAYPNMLQLLKELGIEDRLQWKE 81  Nostoc sp. PCC 7120
CAA75094  73 RVVIAGAGLAGLSAAKYLSDAGHIPIVLEARDVLGGKVAAWKDEDGDWYETGLHIFFGAYPNIQRLLKELNISDRLQWKS 152 Dunaliella salina
P49086    98 QVVVAGAGLAGLSTAKYLADAGHKPILLEARDVLGGKVAAWKDEDGDWYETGLHIFFGAYPNIQNLFGELRIEDRLQWKE 177 Zea mays
BAC09113   2 RVAIAGGGLAGLACAKYLVDAGHTPIVFERANVLGGLVAAWQDADGDWVETGLHAFFGAYPNMLQLLEELGISDRLQWKR 81  Thermosynechococcus...
CAE08772   2 RVAIAGAGLAGLSCAKYLADAGHTPIVVEARDVLGGKVAAWKDEDGDWYETGLHIFFGAYPNMLQLFKELNIEDRLQWKS 81  Synechococcus sp. W...
BAB73531  82 HTLIFNQPDKPGTLSRFDVPD-IPSPFNIIASILRNNDMLTWEQKIRFAIGLLPAIVRGQKYVEEMDKYSFSDWLKRQGV 160 Nostoc sp. PCC 7120
CAA75094 153 HSMIFAMQDKPGQFSRFEFPD-IPAPWNGVVAILRNNEMLSWTEKIKFAIGLLRPIIFGQKYVEEQDELTVTQWMEKQGV 231 Dunaliella salina
P49086   178 HSMIFAMPNKPGEFSRFDFPEtLPAPINGIWAILRNNEMLTWPEKVKFAIGLLPAMVGGQPYVEAQDGLTVSEWMKKQGV 257 Zea mays
BAC09113  82 HALIFNQPEKPGVLSWFDVPD-IPAPFNVLLSILRNNDMLTWEQKLRFALGLWPAIVRGQKYVEAMDQYTLLEWLRRQGI 160 Thermosynechococcus...
CAE08772  82 HSMIFNQQDEPGTYSRFDFPD-LPAPVNGVAAILGNNDMLTWPEKISFGLGLVPAMLRGQGYVEECDKYSWTEWLRVHNI 160 Synechococcus sp. W...
BAB73531 161 GERVASDVFIAASKALTFINPDEVSSTILLTALNRFLQERYGSKIAFLDGSPTERLCQPIVDYITERGGEVRLNAPLKEI 240 Nostoc sp. PCC 7120
CAA75094 232 PSRVNDEVFIAMAKALNFIDPDELSMTVVLTALNRFLQERHGSKMAFLDGAPPERLCEPMVNYFTSRGGELRMNARLKQI 311 Dunaliella salina
P49086   258 PDRVNDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDHIRSRGGEVRLNSRIKKI 337 Zea mays
BAC09113 161 DERVNSDIFIAASKALTFLNPDEVSATIPLTAMNRFLRERYGSKIAFLDGAPPERLCQPIVDYVTARGGEVHTNVALREI 240 Thermosynechococcus...
CAE08772 161 PERVNDEVFLAMSKALNFIDPDEISATVVLTALNRFLQEKSGSKMAFLDGAPPERLCQPVVEHIESLGGEVHLDSPLREI 240 Synechococcus sp. W...
BAB73531 241 LLNPDGTVKGFLLRGLNgepdeVITADFYVSAMAVDPLKVMLPQPWQQMEFFQKLEGLEGVPVINLHLWFDRKLT-DIDH 319 Nostoc sp. PCC 7120
CAA75094 312 VLNEDNSVKHFELLNGE-----IVEGDAYMSAMPVDIMKKLMPQPWKNVPFFQKPNGLEGVPVINIHIWFDRKLS-TVDH 385 Dunaliella salina
P49086   338 ELNPDGTVKHFALSDGT-----QITGDAYVCATPVDIFKLLVPQEWSEITYFKKLEKLVGVPVINVHIWFDRKLNnTYDH 412 Zea mays
BAC09113 241 VLKEDLSVQSFVMADREgqrrfEVTADAYVSAMSVDAIKLLLPKPWQDLPFFQKLNGLEGVPVINVQIWFDRKLP-TVDH 319 Thermosynechococcus...
CAE08772 241 KLNEDGSVAAFHIGGVKgkdsfDLTADAYVSALPVDPFKLLLPKPWKQMEVFRKLDGLRGVPVINLHLWFDRKLT-DIDH 319 Synechococcus sp. W...
BAB73531 320 LLFSRSPLLSVYADMSNTCREYANPDRSMLELVLAPAKDWISKSDEEIVSATMVELEKLFPDHFKGD-NPAKLLKSHVVK 398 Nostoc sp. PCC 7120
CAA75094 386 LLFSRSELLSVYADMSTTCKEYSDDKASMLELVFAPAADWIGRPDSEIVDATMKELEKLFPNEIKADqSLAKIRKSKVIK 465 Dunaliella salina
P49086   413 LLFSRSSLLSVYADMSVTCKEYYDPNRSMLELVFAPADEWIGRSDTEIIDATMEELAKLFPDEIAADqSKAKILKYHIVK 492 Zea mays
BAC09113 320 LLFSRSPLLSVYADMSETCRGYADPDKSMLELVLAPAAEWIGRSDEDIIEATLAELAKLFPNHLP---EPAKVLKTAVVK 396 Thermosynechococcus...
CAE08772 320 LLFSRSPLLSVYADMSITCKEYEDPDKSMLELVFAPAKDWIGRPDEEIIEATMSELHKLFPMHFGGD-NPATLLKYKVVK 398 Synechococcus sp. W...
BAB73531 399 TPRSVYKATPGRQQYRPAQKTPIANFFLSGSYTMQRYLGSMEGAVLSGKLTAQAIC 454 Nostoc sp. PCC 7120
CAA75094 466 TPLSVYKSTAGREKYRPSQKTPIPNFYLAGDYTKQKYLASMEGAVFSGKLACEQVV 521 Dunaliella salina
P49086   493 TPRSVYKTVPNCEPCRPLQRSPIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIV 548 Zea mays
BAC09113 397 TPRSVYKATPGRQAFRPHQATPIPNFFLSGSYTLQPYLGSMEGAVLSGKLTAQAIA 452 Thermosynechococcus elongatus BP-1
CAE08772 399 TPLSVYKTTPGCQQLRPDQTTPIKNFFLAGDYTMQRYLASMEGAVLSGKLCAGAVD 454 Synechococcus sp. WH 8102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap