Conserved Protein Domain Family
carot_isom

?
TIGR02730: carot_isom 
carotene isomerase
Members of this family, including sll0033 (crtH) of Synechocystis sp. PCC 6803, catalyze a cis-trans isomerization of carotenes to the all-trans lycopene, a reaction that can also occur non-enzymatically in light through photoisomerization. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131777
View PSSM: TIGR02730
Aligned: 4 rows
Threshold Bit Score: 944.239
Threshold Setting Gi: 19550437
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE07416   7 WDAVVIGSGIGGLVTASQLAAKGARTLVLERYLIPGGSGGAFKREGYTFDVGASMIFGFGEKGYTNLLTRALADVGEHCE 86  Synechococcus sp. W...
BAA10798   7 YDAIVIGSGIGGLVTATQLVSKGLKVLVLERYLIPGGSAGYFEREGYRFDVGASMIFGFGDRGTTNLLTRALAAVGQALE 86  Synechocystis sp. P...
BAB73763  13 FDVIVIGSGIGGLVTATQLATKGAKVLVLESYIIPGGSAGYFERQGYRFDVGASMIFGLGNRGTTNLLTRALQAVNSSVD 92  Nostoc sp. PCC 7120
AAL91366  98 YDAIVIGSGIGGLVAATQLAVKGAKVLVLEKYVIPGGSSGFYERDGYKFDVGSSVMFGFSDKGNLNLITQALAAVGRKLE 177 tomato
CAE07416  87 TIPDQAQLEYHMPGGLNIAVDRDYETFIADLSARFPHEATGVRRFYDTCWQVFNCLDAMPLLSLEDPAYLTKVFFKAPLA 166 Synechococcus sp. W...
BAA10798  87 TLPDPVQIHYHLPGGLDPKVHREYEAFLQELIAKFPQEAQGIRRFYDECWQVFNCLNTMELLSLEEPRYLMRVFFQHPGA 166 Synechocystis sp. P...
BAB73763  93 AIADPVQIHYHLPNNLNLKVDRVYDKFLQNLAAYFPHEKEGIRGFYDECWQVFKCLNRMELLSLEEPRYLLRSFLQHPLA 172 Nostoc sp. PCC 7120
AAL91366 178 VIPDPTTVHFHLPNDLSVRIHREYDDFIEELVSKFPHEKEGIIKFYSECWKIFNSLNSLELKSLEEPIYLFGQFFKKPLE 257 tomato
CAE07416 167 CLGLARWLPFNVGAVARQHINDEQLLKFIDIECFCWSVMPADRTPMINAGMVFSDRHAGGINYPRGGVGVIAEKLVHGLE 246 Synechococcus sp. W...
BAA10798 167 CLGLVKYLPQNVGDIARRHIQDPDLLKFIDMECYCWSVVPADLTPMINAGMVFSDRHYGGINYPKGGVGQIAESLVAGLE 246 Synechocystis sp. P...
BAB73763 173 CLGLLKYLPQNAGDIARRYIKDPELLKFIDIECYCWSVVPAAMTPMINAGMVFSDRHYGGVNYPKGGVGQIAQKLVEGLE 252 Nostoc sp. PCC 7120
AAL91366 258 CLTLAYYLPQNAGSIARKYIRDPGLLSFIDAECFIVSTVNALQTPMINASMVLCDRHFGGINYPVGGVGEIAKSLAKGLD 337 tomato
CAE07416 247 RHGGAIRYKARVTKVLLENGEAVGVKLADGETIRAKRVISNATRWDTFSgqddgstragqALVDEANTPKKEAFWRRRYV 326 Synechococcus sp. W...
BAA10798 247 KFGGKIRYGARVTKIIQENNQAIGVELANGEKIYGRRIVSNATRWDTFG-----------ALTGDQPLPGKEKRWRRNYQ 315 Synechocystis sp. P...
BAB73763 253 KAGGEIRYQAKVAKIITEKDCAVGVQLTNGEIYRGKRIVSNATRWDTFD-----------KLLPVDQIPSNEKKWQQNYK 321 Nostoc sp. PCC 7120
AAL91366 338 DHGSQILYRANVTSIILDNGKAVGVKLSDGRKFYAKTIVSNATRWDTFG-----------KLLKAENLPKEEENFQKAYV 406 tomato
CAE07416 327 PSPSFLSLHLGVRADLIPAGTHCHHLLLED-WNRMEDEQGVIFVSMPSLLDPDLAPAGHHIVHTFTPSSMEAWQGLSPTD 405 Synechococcus sp. W...
BAA10798 316 QSPSFLSLHLGVEADLLPEGTECHHILLED-WDDLEKEQGTIFVSIPTLLDPSLAPDGYHIIHTFTPSWLESWQNLSPQE 394 Synechocystis sp. P...
BAB73763 322 KSPSFLSLHIGVKESVLPQGTECHHIILED-WQNMTQPEGTLFVSIPTLLDPELAPEGYHIIHAFTPNWMNDWHGLSVSD 400 Nostoc sp. PCC 7120
AAL91366 407 KAPSFLSIHMGVKADVLPPDTDCHHFVLEDdWTNLEKPYGSIFLSIPTVLDSSLAPEGHHILHIFTTSSIEDWEGLSPKD 486 tomato
CAE07416 406 YRAKKEADAARLIQRLEA-ILPGLSEAITHKEIGTPRSHRRFLGRFQGSYGPIPAMQLPGLLPMPFNRTGVPNLYCVGDS 484 Synechococcus sp. W...
BAA10798 395 YEAKKEADSGKLIDRLEA-IFPGLDRALDYMEIGTPRSHRRFLGRQNGTYGPIPRRRLPGLLPMPFNRTAIPGLYCVGDS 473 Synechocystis sp. P...
BAB73763 401 YEAKKEETAWRIIDRLEK-IFPGLDAGLDYLEVGTPRTHRRFLGREDGTYGPIPRRKLRGLLSMPFNRTAIKGLYCVGDS 479 Nostoc sp. PCC 7120
AAL91366 487 YEAKKEVVAERIISRLEKtLFPGLKSSILFKEVGTPKTHRRYLARDSGTYGPMPRGTPKGLLGMPFNTTAIDGLYCVGDS 566 tomato
CAE07416 485 CFPGQGLNAVAFSGFACAHRVGADLG 510 Synechococcus sp. WH 8102
BAA10798 474 TFPGQGLNAVAFSGFACAHRLAVDLG 499 Synechocystis sp. PCC 6803
BAB73763 480 TFPGQGLNAVAFSGFACAHRIAVDLG 505 Nostoc sp. PCC 7120
AAL91366 567 CFPGQGVIAVAFSGVMCAHRVAADLG 592 tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap