Conserved Protein Domain Family
spore_gerQ

?
TIGR02728: spore_gerQ 
spore coat protein GerQ
Members of this protein family are the spore coat protein GerQ of endospore-forming Firmicutes (low GC Gram-positive bacteria). This protein is cross-linked by a spore coat-associated transglutaminase. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131775
View PSSM: TIGR02728
Aligned: 3 rows
Threshold Bit Score: 142.344
Threshold Setting Gi: 22778713
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P39620    92 LPVEESYIENILRLNRGKTATIYMTFENSKEWgsKIFRGVIEAAGRDHIIISDPKSGTRYLLLTIYLDYITFDEEIAYTY 171 Bacillus subtilis s...
BAC14981  68 LPVQQSFIENILRMNRGELGTFYMTFENSSQQ--TEFRGYIEEAGRDHILIREEGSQRRFLLLMVYLDYVTFDNEINYSY 145 Oceanobacillus ihey...
BAD39850  90 IPQEQSYVENILRMNRGKTATVYATYDNNPEWaaRVFRGQVENAARDHVVLSDPQTGMRYVILMVNIDYLTFDEPLRYPE 169 Symbiobacterium the...
P39620   172 PY 173 Bacillus subtilis subsp. subtilis str. 168
BAC14981 146 PY 147 Oceanobacillus iheyensis HTE831
BAD39850 170 EI 171 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap