Conserved Protein Domain Family
phenyl_P_delta

?
TIGR02726: phenyl_P_delta 
phenylphosphate carboxylase, delta subunit
Members of this protein family are the alpha subunit of phenylphosphate carboxylase. Phenol (methyl-benzene) is converted to phenylphosphate, then para-carboxylated by this four-subunit enzyme, with the release of phosphate, to 4-hydroxybenzoate. The enzyme contains neither biotin nor thiamin pyrophosphate. This delta subunit belongs to HAD family hydrolases. [Energy metabolism, Anaerobic]
Statistics
?
PSSM-Id: 131773
View PSSM: TIGR02726
Aligned: 2 rows
Threshold Bit Score: 279.628
Threshold Setting Gi: 56313239
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC12689   1 MEQAKNIKLVILDVDGVMTDGRIVINDEGIESRNFDIKDGMGVIVLQLCGVEVAIITSKKSGAVRHRAEELKIKRFHEGI 80  Thauera aromatica
CAI07884   1 MEQAKNIKLVILDVDGVMTDGRIVINDEGIESRNFDIKDGMGVIVLQLCGIDVAIITSKKSGAVRHRAEELKIKRFHEGI 80  Aromatoleum aromati...
CAC12689  81 KKKTEPYAQMLEEMNISDAEVCYVGDDLVDLSMMKRVGLAVAVGDAVADVKEVAAYVTTARGGHGAVREVAELILKAQGK 160 Thauera aromatica
CAI07884  81 KKKTEPYAQMLEEMNISDAEVCYVGDDLVDLSMMKRVGLAVAVGDAVADVKEAATYVTTARGGHGAVREVAELILKAQGK 160 Aromatoleum aromati...
CAC12689 161 WDAMLSKIH 169 Thauera aromatica
CAI07884 161 WDAVLAKIH 169 Aromatoleum aromaticum EbN1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap