Conserved Protein Domain Family
phenyl_P_gamma

?
TIGR02725: phenyl_P_gamma 
phenylphosphate carboxylase, gamma subunit
Members of this protein family are the gamma subunit of phenylphosphate carboxylase. Phenol (methyl-benzene) is converted to phenylphosphate, then para-carboxylated by this four-subunit enzyme, with the release of phosphate, to 4-hydroxybenzoate. The enzyme contains neither biotin nor thiamin pyrophosphate. The gamma subunit has no known homologs.
Statistics
?
PSSM-Id: 131772
View PSSM: TIGR02725
Aligned: 2 rows
Threshold Bit Score: 156.763
Threshold Setting Gi: 38228893
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE54291  1 MNQWEVFVMDPAELPEGKQLELSVRTLNPGLKKYTYQRVRAEVSPALDKFPDQLQVRLGRGQLSPQRFSIRIIETVQRMP 80  Thauera aromatica
CAI07882  1 MNQWEVFVMDLAELPEGTELELSVRTLNPGLKKYTYQRVKAELSNALDKFPDRLQVRFGRGQLCSQQFSIRIIEQVQRMP 80  Aromatoleum aromatic...
CAE54291 81 AKYL 84  Thauera aromatica
CAI07882 81 AKYL 84  Aromatoleum aromaticum EbN1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap