Conserved Protein Domain Family
phenyl_P_beta

?
TIGR02724: phenyl_P_beta 
phenylphosphate carboxylase, beta subunit
Members of this protein family are the beta subunit of phenylphosphate carboxylase. Phenol (methyl-benzene) is converted to phenylphosphate, then para-carboxylated by this four-subunit enzyme, with the release of phosphate, to 4-hydroxybenzoate. The enzyme contains neither biotin nor thiamin pyrophosphate. This beta subunit is homologous to the alpha subunit and, more broadly, to UbiD family decarboxylases.
Statistics
?
PSSM-Id: 131771
View PSSM: TIGR02724
Aligned: 2 rows
Threshold Bit Score: 983.048
Threshold Setting Gi: 56313240
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC12688   1 MDLRYFINQCAEAHELKRITTEVDWNLEISHVSKLTEEKKGPALLFESIKGYDTPVFTGAFATTKRLAVMLGLPHNLSLC 80  Thauera aromatica
CAI07885   1 MDLRYFINQCAEAHELKRVTTEVDWNLEISHVSKLTEEKKGPALLFESIKGYDTPVFTGAFATTKRLAIMLGLPHHLTLC 80  Aromatoleum aromati...
CAC12688  81 ESAQQWMKKTITSEGLIKAKEVKDGPVLENVLSGDKVDLNMFPVPKFFPLDGGRYIGTMVSVVLRDPETGEVNLGTYRMQ 160 Thauera aromatica
CAI07885  81 ESAQQWMKKTITSEGLIKAKEVKDGPVLENVLSGGKVDLNMFPVPKFFPLDGGRYIGTMVSVVLRDPETGEVNLGTYRMQ 160 Aromatoleum aromati...
CAC12688 161 MLDDKRCGVQILPGKRGERIMKKYAKMGKKMPAAAIIGCDPLIFMSGTLMHKGASDFDITGTVRGQQAEFLMAPLTGLPV 240 Thauera aromatica
CAI07885 161 MLDDKRCGVQILPGKRGERIMKKYAKLGKKMPAAAIIGCDPLIFMAGTLMHKGASDFDITGTVRGQQAEFLMAPLTGLPV 240 Aromatoleum aromati...
CAC12688 241 PAGAEIVLEGEIDPNAFLPEGPFAEYTGYYTDELHKPIPKPVLEVQQILHRNSPILWATGQGRPVTDVHMLLAFTRTATL 320 Thauera aromatica
CAI07885 241 PAGAEIVLEGEIDPNAFLPEGPFAEYTGYYTDELHKPIPKPVLEVQQILHRNNPILWATGQGRPVTDVHMLLAFTRTATL 320 Aromatoleum aromati...
CAC12688 321 WTELEQMRIPGIQSVCVMPESTGRFWSVVSVKQAYPGHSRQVADAVIASNTGSYGMKGVITVDEDIQADDLQRVFWALSC 400 Thauera aromatica
CAI07885 321 WTELEQMRIPGVQSVCVLPESTGRFWSVVSLKQAYPGHSRQVADAVMGSNTGSYGMKGIITVDEDIAADDLQRVFWALSC 400 Aromatoleum aromati...
CAC12688 401 RYDPARGTELIKRGRSTPLDPALDPNGDKLTTSRILMDACIPYEWKQKPVEARMDEEMLAKIRARWHEYGID 472 Thauera aromatica
CAI07885 401 RYDPMRGTELIKRGRSTPLDPALDPDGDKLTTSRILMDACIPYEWKQKPVEARMDEEMLAKIRARWHEYGID 472 Aromatoleum aromaticum EbN1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap