Conserved Protein Domain Family
sider_RhtX_FptX

?
TIGR02718: sider_RhtX_FptX 
siderophore transporter, RhtX/FptX family
RhtX from Sinorhizobium meliloti 2011 and FptX from Pseudomonas aeruginosa appear to be single polypeptide transporters, from the major facilitator family (see pfam07690) for import of siderophores as a means to import iron. This function was suggested by proximity to siderophore biosynthesis genes and then confirmed by study of knockout and heterologous expression phenotypes. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131765
View PSSM: TIGR02718
Aligned: 3 rows
Threshold Bit Score: 490.175
Threshold Setting Gi: 81622117
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9HWG8       9 RLVITLALLYLSQGIPIGLAMDALPTLLRQDGAPLQALAFLPLVGLPWVVKFLWAPWVDNHWSRR-LGRRRSWILPMQCM 87  Pseudomonas aerug...
CAH38051     9 RLVITITLLYLSQGIPIGIAMDAMPTLLRHDGAPLHALAFLPLVGLPWVVKFLWAPVVDNRWSAR-IGRRRSWMLPMQCI 87  Burkholderia pseu...
SU:SMa2337  33 RLYAVLGGLYLAQGIPTYLLLVALPPLMRESGASRTAIGLFSLLMLPLVLKFAVAPLVDRWAPWPgLGHRRGWVVPTQLL 112 Sinorhizobium mel...
Q9HWG8      88 VLACLLGLATLGLGVASAGWAVGLLALASLASATQDIATDGMAAEHFSGELLAKVNAVQIAGVMIGFFGGGAGSLILAGH 167 Pseudomonas aerug...
CAH38051    88 VVLCLASLAQIGMTVATAGWAVGLLAVASLASATQDIANDGMAAEHFRGGALAKINAIQIAGVMIGFFGGGAGALTLIGL 167 Burkholderia pseu...
SU:SMa2337 113 VSAGIASMALVEPDRAGTLFAIG--ICITLLSSVQDIATDGYAVRHLNGRTLAIGNAVQAGSIALGVIVGGTLTLVLFHK 190 Sinorhizobium mel...
Q9HWG8     168 FGQRTAFLVMACVPLASLCCVLALGRGDPHELPPAPAAKASLLRFLRRPLAPSLLALALLSAMTAVSGFGLSKLYLSDAG 247 Pseudomonas aerug...
CAH38051   168 FGQRAAFLALAAVPLASLACVLWLMPREAGRPGAPRAHDASLARFAKRPLSLSLLALALLSAMTAVSGFGLSKLFLNDAG 247 Burkholderia pseu...
SU:SMa2337 191 IGWRPTILLVACLSLLPLVAAIWMKDRAVASPEAPLRRRASLFGFFRRPNAWMILAFALTYRASEGLVRGMEGSYLVDSK 270 Sinorhizobium mel...
Q9HWG8     248 WALQDIGRLGMSGGLVTVFLGCGGGAWLVRRIGLWRGFALGVVLAGCSALLWYLQAGRWLALSEGLAWTCVLIGSLATGI 327 Pseudomonas aerug...
CAH38051   248 WTLEAIGRLGMAGGIVTVVLGCGGGAWLVRRLGLWRAFSAGVSCAGAGALLWFAQANGWLASAPHWVWLCTVLGSLSTGI 327 Burkholderia pseu...
SU:SMa2337 271 VPTEWIGYMSGAAAATAGLLGALIAALIIRKAGLTATLILLGGLR-SLCFLAFALNAFGIWPGIAVAMSASAFQTLIRYM 349 Sinorhizobium mel...
Q9HWG8     328 TSVAILTAAMRFAGQGGQAGTDVTAVQSTRDLGEMLASSFLVSLTAQIGYAGGFLTGSALAVLALLLALRL 398 Pseudomonas aeruginosa
CAH38051   328 TSVSIMTAGMRFAGDGDQAGTDVTAVQSTRDLGELIASSMMLTLTSKVGYSGGFLAGAVLAALAALIAARL 398 Burkholderia pseudomallei ...
SU:SMa2337 350 ELVAIYSFFMASSSD-DQPGTDFTILSCAELVVYLIGTSIAGYVADRFGYATLFSSATVISVLGIGLSVWM 419 Sinorhizobium meliloti 1021
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap