Conserved Protein Domain Family
AcCoA-syn-alpha

?
TIGR02717: AcCoA-syn-alpha 
acetyl coenzyme A synthetase (ADP forming), alpha domain
Although technically reversible, it is believed that this group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which it has been characterized. In most species this protein exists as a fused alpha-beta domain polypeptide. In Pyrococcus and related species, however the domains exist as separate polypeptides. This model represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. In reference, one of these (along with its beta-domain partner) was characterized as ACS-II showing specificity for phenylacetyl-CoA. This model has been constructed to exclude these non-ACS-I paralogs. This may result in new, authentic ACS-I sequences falling below the trusted cutoff.
Statistics
?
PSSM-Id: 131764
View PSSM: TIGR02717
Aligned: 12 rows
Threshold Bit Score: 612.007
Threshold Setting Gi: 56312692
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAI07337       13 LHDFLAPGSIAIIGASTDPTKRGYKAMVGLIKDgYPGAIYPINPKVD--NVLG--VRTYATLDDI--PGPVDLALICTPA 86  Aromatoleum ar...
vng:rrnAC0888   4 LSTLFAPERVAVVGATDSEGSVGHAVTTNLLDS-FTGEVVAVNPNKE--TVLG--LPCYDNLARLddPGSVDVAVVVVPP 78  Haloarcula mar...
AAB90033        1 MERLFYPKVVAVIGASPQEGKVGNTIMKNLRN--FSGTVYAVNPKYR--EILG--FPCYPSVLKI--PENVDLAIIVVPA 72  Archaeoglobus ...
Q58010          8 LKYISYPKSVAIIGASKTEGKVGYAIMKNLKDFn--GKIYPINPKYD--EIFG--IKCYKSVLDV--EDDIDLAVIVVPN 79  Methanocaldoco...
AAL81664        3 LEALFNPKSVAVIGASAKPGKIGYAIMKNLIEYgYEGKIYPVNIKGGeiEINGrkFKVYKSVLEI--PDEVDMAVIVVPA 80  Pyrococcus fur...
BAB60399        3 LKKLFYPDSVAVIGASNDNTKIGYQIIRNLKEGgYKGKIYPINTKDG--TILG--YKAYPSILDV--PDEVDLAILSIPA 76  Thermoplasma v...
AAM94652        1 LAFFTNPTSIAVIGASSAAGKVGYTVVDNIKTSgYTGKVYPINPKAP--EING--FKAYPNITAC--PETPELAVFVIPA 74  Spironucleus b...
AAF88064        3 FEPLFNPKSVPVIGASDRKESVGYAVMNNMIKGgYKGNLYPVGRKP---ELFG--KKCYAKIGKI--EEKVDLAVIAIPA 75  Entamoeba hist...
AAB89736      191 LKHFFNPESVAVIGASRDVEKVGGRTFYNLLTYrFNGVAYPVNRAAK--AIMG--VRAYPTISEV--PDEVELAVLSVPV 264 Archaeoglobus ...
BAB66609        3 LEYLFKPKSIAVIGASRYKEKVGNVVFRNLLYT-YHGKLYPVNSKAE--DVEG--VKAYKSVKEI--PDPIDMVVITVPR 75  Sulfolobus tok...
CAG35387        2 LEHLFSPNKIAVIGASRQVGAVGHDIVKNLIEGgFAGEIIPVNPAGG--TLLG--LPVYTSLKEY--KESLDMAIIAVNK 75  Desulfotalea p...
WP_011343212   16 VAKLLNPRSIAVIGASEKPEKLGNAILRNIVSG-YKGEVFGVNPRVK--KIQE--IEVYPDVFSL--PYPVDLAVIVLPA 88  Carboxydotherm...
CAI07337       87 ATVPGLVADCGRKGVKGAAILASGFRETGPAGARLEQQVLAAAREGGVRLIGPNTSGMFNLH---KKVNLLALANVKPGN 163 Aromatoleum ar...
vng:rrnAC0888  79 TVAVEVIENAGEAGIENVVVITAGFGETGSDGAEREKRLREAASEYDLNLVGPNSLGVMSTPv--GLNATFGNEMASDGD 156 Haloarcula mar...
AAB90033       73 KLVPKAVEECGRKDVEGAVVISAGFKEAGIEGAKLERELVEVAERYGVKLVGPNCLGMINTEi--AMNATFSRVAPEKGR 150 Archaeoglobus ...
Q58010         80 IVVPKVLEECGKKGVKGAVIITAGFSEVGN--YELENKIKEIAKRYNIRIIGPNCLGIMNTHi--NLNATFAKVFPPKGG 155 Methanocaldoco...
AAL81664       81 KFVPQVLEECGQKGVKVVPIISSGFGELGEEGKKVEQQLVETARKYGMRILGPNIFGVVYTPa--KLNATFGPTDVLPGP 158 Pyrococcus fur...
BAB60399       77 KYTPQAAEECGRKGVFGIIVVASGFSEVGN--KDLEDQLANTCKKYGVRLLGPNVVGLMNNVi--KLNASFAPYLPYPGT 152 Thermoplasma v...
AAM94652       75 KHCLATAEECGQKGVRGCVIISAGFKEVGGDGIELEQKLVAIGKKYDMRIVGPNVLGVSTP----SFNCTFASRHPRKGP 150 Spironucleus b...
AAF88064       76 KFVPGVCIECGEAGVKGLIIITAGFAEAGEEGKKMCIEIQATCQKYNMRMIGPNCLGIINPRd--GVNASFASVMPEAGG 153 Entamoeba hist...
AAB89736      265 KYALEVAEECGKKGVKALLVLTAGFAEVGGEGVERQKKLVEICRKYGMRLIGPNCMGIINTApetRLLATFAPTPPNEGS 344 Archaeoglobus ...
BAB66609       76 EAVPQVMEEAVEKNVKAAIVITAGFKEVGE--AELEDKVISIARKGGIRVLGPNTFGIITP----EFNATFAYTDVKRGN 149 Sulfolobus tok...
CAG35387       76 DLIIDVVQDALSKRCTTIVAIGAGFKESGDEGAMLEQEVLTLCKRSGARLLGPNCLGFINTEl--KINASFAGPMPRKGG 153 Desulfotalea p...
WP_011343212   89 EKAVVALKEAAEAGVKSAVVISGGFKETGNEGALLEEEIKKIALDFEMPVLGPNCVGIVNNNl--QLNATFLRTAPLKGE 166 Carboxydotherm...
CAI07337      164 IGFISQSGNMLLSLVLEAEHNgHVGFSTYVGPGNQTDIGFNDYLRYLGEDPDTRVATFYVEGFRDGQRFLHNAREITAVK 243 Aromatoleum ar...
vng:rrnAC0888 157 ISFMSQSGAFITAVLDWAAER-DVGFKDIVSLGNKAVLDESDFVAEWGDDPDTDVILGYLEDINDGSSFVQTAREVTQET 235 Haloarcula mar...
AAB90033      151 IAFLSQSGAFILAVLEWSKRN-GVGFSKVVSLGNKAMLDESDFLEYLAKDDSTDVILIYMEGVEDGRKFMRVAKSVARRK 229 Archaeoglobus ...
Q58010        156 VSIISQSGAVLNAILDIAPLL-NIGFSKVVSIGNKADIQESDLLEYFLDDEDTKIVVLYIEGLKD-KRFLKVAKKLSKKK 233 Methanocaldoco...
AAL81664      159 LALISQSGALGIALMGWTILE-KIGLSAVVSVGNKADIDDADLLEFFKDDENTRAILIYMEGVKDGRRFMEVAKEVSKKK 237 Pyrococcus fur...
BAB60399      153 IGMISQSGALIVGLDAMTWAN-KTGTSFLISIGNMADLDFSDLVTFLADDENVSCISLYAEGLKAGRKFVDTARLIN--K 229 Thermoplasma v...
AAM94652      151 IAFLSQSGAMLTSILDWSFAN-NIGFSNFISLGNKCDVHETELIEEVCEDDNTKIILLYLESIVDGPAFLERVSVASRKK 229 Spironucleus b...
AAF88064      154 VAFISQSGALCTAILDWAANQ-HVGFSYFVSIGSSIDTDYADLFEFFAKDPKVTSILMYIESIKDAKKFVLRAREFAADK 232 Entamoeba hist...
AAB89736      345 IAFASQSGAVGLALMDRVNNY-GLGLSYFVSLGNSADITSNDLIEFWEEDGRTKLIMLYQESIPNPRKFARLAKRISKKK 423 Archaeoglobus ...
BAB66609      150 IALVVQSGGLGVYMLNWAQKY-RVGISYMVSLGNQADVKEYEVIEYLSRDPETRAIFVYLEGVSDGNSFLETLPEATKRK 228 Sulfolobus tok...
CAG35387      154 ISIFSQSGALATAMLDQAEQR-GLGVSKLISVGNKADITENDLLSYFAADSSTKVVAGYLENIVNGNNFLKHATHISRKK 232 Desulfotalea p...
WP_011343212  167 IAFVSQSGAILSTVLEWSLKE-DLGFSYMISMGNKAVLNEADFLPAIANDPGTAVILLYIEDVVEGSSFLKKAYEASLLK 245 Carboxydotherm...
CAI07337      244 PVVVYKSGATEQGKKAASSHTGALAGSY-AMTVDLLRQVGVSVVQHSNEILPVAEGLGLLQHAp-----GKRVAVVSDGG 317 Aromatoleum ar...
vng:rrnAC0888 236 PIVLVKSGRTDAGASAAASHTGAMAGSE-RAYEAGLDKAGTLRVESVQELFDYAQILAGQPLPd-----GDEIAIVTNAG 309 Haloarcula mar...
AAB90033      230 PVVVMKAGKSQSGAKAASSHTGSLAGSY-EAYRAAFRQSGVIEASSVEELFDFALLLLKYRKAg-------NLAILTNSG 301 Archaeoglobus ...
Q58010        234 PIIALKSGRTEVGKKAAKSHTGSLAGED-VIYEAAFKEAGIIRAYTFEELVDLIHLFSTQPTIs-----SNEIGIITNAG 307 Methanocaldoco...
AAL81664      238 PIIVIKAGRSERGAKAAASHTGSLAGSD-KVYSAAFKQSGVLRAYTIGEAFDWARALSNLPEPq-----GDNVVIITNGG 311 Pyrococcus fur...
BAB60399      230 PIVMLKSGVSKHGSVAAASHTGSLAGSH-RVYDGALKQAGVIRAYSIEELFDLSLTLSLQKPMk-----GDNLIVVTNGG 303 Thermoplasma v...
AAM94652      230 PIIILKSGTSLAGAAAASSHTGALAGND-IAFDLAFAQAGVIRAKTMSELFSLARLFSNTNFNtlkavqDRKFVIITNAG 308 Spironucleus b...
AAF88064      233 PIILLKAGKSSEGAAAAMSHTGSLAGND-AVYDAVFDRCGCIRVDSICDLWDCAHVLATQNIPq-----NNRLCIITNAG 306 Entamoeba hist...
AAB89736      424 PILAIASGVTPAGAKAVASHTGAIVSSSgIAIDALFKQTGIIRASSIDELFSISEFLLHQPLPk-----GNRVCIVTNGG 498 Archaeoglobus ...
BAB66609      229 PVVFLKGGTTSNGAAAAKTHTGSLAGSF-EVFKAAVRTVGGILVDNLHDMLNLAKLLMYSEPV------TEELLVITNSG 301 Sulfolobus tok...
CAG35387      233 PVILLKSGTSEAGQKSATSHTGAFTGTD-TAYGAAFKRAGIVRADNFDDLFDCTMAFSNQPLPk-----GNRVLIISNAG 306 Desulfotalea p...
WP_011343212  246 PVVVFKAGISTAGAKAASSHTGALAGSI-EGYKLAFAKTGLIRAKTLEEMFIYARVFASGQKVt-----GKNIGIVTNSG 319 Carboxydotherm...
CAI07337      318 GQATIASDRIIEAGLELAELGEATKKRLGAILLPQASPVNPVDVAGssDANPALLADCLAIVADDDNVDAVFLVGMFGgY 397 Aromatoleum ar...
vng:rrnAC0888 310 GPGVMTTDAVGDSDLQLAQFGDKTFSRLREEMPDEANIYNPVDIIG--DAPAERFETALETVLADDNVSMAVVVACPT-A 386 Haloarcula mar...
AAB90033      302 GPGVMAADACDQFGVPLANFNFETIRKLKEFLPAESNFYNPVDILG--DASAERFSRSLQILSEDENVDIVLTILTPT-A 378 Archaeoglobus ...
Q58010        308 GFGVLAADSCVDYNMKLSNFEKSTIEKLKNILPPTANISNPLDIIG--DATPERYKKVIEVLAEDSNVKGLLVILTPQ-E 384 Methanocaldoco...
AAL81664      312 GIGVMATDAAEEEGLHLYDNLEELK-IFANHMPPFGSYKNPVDLTG--MADGKSYEGAIRDALAHPEMHSIAVLYCQT-A 387 Pyrococcus fur...
BAB60399      304 GIGVLATDQAEASGLPLQTPSNDLQGKIKQIIPSFGSTKNPIDMSA--MATPQIYADTIKTVMEDESVDGLVVLYCEV-A 380 Thermoplasma v...
AAM94652      309 GPGIIATDAFETFGVSLSQMTEATKDALRKALPEEASVKNPVDVIG--DATPDRYAKAMEIAFTDPNVDGCLVLVTPQ-A 385 Spironucleus b...
AAF88064      307 GPGVISTDRLVSVHGHLAKLSESTMNELNAFLSPFWSHSNPVDVLG--DATAGVYQKTLDIVIKDPQIDGVVVVLTPQ-A 383 Entamoeba hist...
AAB89736      499 GLGAITSDWCHQVGLEIAELSERTQESLRNLLPEIASVKNPVDMTA--SADVRMYGQTLKTVAEDENVDAIICIFVAA-V 575 Archaeoglobus ...
BAB66609      302 GHGVLTSDEIEKNGLRMVEIPDWMKETLRKILPPTSVPRNPLDLTG--DANKERYYSALKIVSELN--STKLVIVQAL-P 376 Sulfolobus tok...
CAG35387      307 GTGTIAADAVEHTGFKVAEPPSNKTNSLRGRKPIYSDIESPVYVLG--DAPAALYVEAISTAQEDSNVDAIVLVLTPA-A 383 Desulfotalea p...
WP_011343212  320 GPGVITADRLELNGLNITGLSAKTINELKTFLPRAASFGNPVDILG--DADEEKYAMTLKTVLDDEKVDGVVAVYGKT-A 396 Carboxydotherm...
CAI07337      398 HIRfAEDLLGGEMRgAESMIELarridkPVVVYSLYAPVKPPALRRLHEAGLPVYTSIEYAVRVLAALGERG 469 Aromatoleum aromaticum...
vng:rrnAC0888 387 VLS-FEELSERIVE-QQEQFGK------PVAATLMGGKSVDAGANVLSEAGVPNYFDPARAVGSLGALKRYR 450 Haloarcula marismortui...
AAB90033      379 QMD-FLKAAESVV-------GK------NAVCCFMGGESVDESERILRSSGIPNFFDPVRAVRAISVLGRYS 436 Archaeoglobus fulgidus...
Q58010        385 MTK-PLEVAKSIIEvKNSHKEFkn---kPLITSFVGGVSVKGAKSYLRKNGIPAYITPENGVKALSHLYKYS 452 Methanocaldococcus jan...
AAL81664      388 VLD-PRELAEIVIReYNESGRKk-----PLVVAIVGGIEAKEAIDMLNENGIPAYPEPERAIKALSALYKWS 453 Pyrococcus furiosus DS...
BAB60399      381 NLD-PSDAAKGIINgVLSSNRKi-----PVVAGFVGGENSINASLYLIKNGIPTFDSPDKAVKAISALRKHQ 446 Thermoplasma volcanium...
AAM94652      386 QTQ-PDEVARLCVEvQKKNPDK------LIVTSFMGGDTMKSPAQILATGNISNYDFPEPALQAIRAVCDYA 450 Spironucleus barkhanus
AAF88064      384 MTD-PVAVAKSLVEhGPYQNQ-------SLPHGWVNQKSEAGVK-ILEEGKIPNFETPERAVTAFGYIMRHP 446 Entamoeba histolytica
AAB89736      576 SEEkSEEVEKAVISaAKYANSVg----kPVVYIYISSDS--KDGVIGDEVKVPVYVFPNTAAKVLGKVVEYA 641 Archaeoglobus fulgidus...
BAB66609      377 MVS-CTDVARVISNfKGKG-----------VIGITMGLDEDTALKILETTGIPAYTFPEDAVKAIKYFVNKP 436 Sulfolobus tokodaii st...
CAG35387      384 MTE-AKAVLLGIAEvLDGSKP--------LLCCLMGGGAYVPPMHELVDAGLAIFPTPERAVAAFSAMYNHA 446 Desulfotalea psychroph...
WP_011343212  397 VID-MEKMVQAVINgRRKNPDK------PVVACFLGGVDSRRAKELLNKNKIPFYSFPEAAADALAVLYRYY 461 Carboxydothermus hydro...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap