1X19


Conserved Protein Domain Family
C20_methyl_CrtF

?
TIGR02716: C20_methyl_CrtF 
Click on image for an interactive view with Cn3D
C-20 methyltransferase BchU
Members of this protein family are the S-adenosylmethionine-depenedent C-20 methyltransferase BchU, part of the pathway of bacteriochlorophyll c production in photosynthetic green sulfur bacteria. The position modified by this enzyme represents the difference between bacteriochlorophylls c and d; strains lacking this protein can only produced bacteriochlorophyll d. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131763
View PSSM: TIGR02716
Aligned: 3 rows
Threshold Bit Score: 308.133
Threshold Setting Gi: 21645919
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1X19_A       42 LIEFSCMKAAIELDLFSHMAEGPKDLATLAADTGSVPPRLEMLLETLRQMRVINLEDGKWSLTEFADYMFSPTPKEPNLH 121 Chlorobium tepid...
AAG15232     37 TVDFFVIKAAKDLGLFDLLASAPRTLADLATLTETVPPRLEKFLITMEQIGLVTRQGDAWQLTPFADQFFADPERHRNMT 116 Chloroflexus aur...
tigr:CT0028  21 LIEFSCMKAAIELDLFSHMAEGPKDLATLAADTGSVPPRLEMLLETLRQMRVINLEDGKWSLTEFADYMFSPTPKEPNLH 100 Chlorobium tepid...
1X19_A      122 QTPVAKAMAFLADDFYMGLSQAVRGQKNFKGQVPYPPVTREDNLYFEEIHRSNAKFAIQLLLEEAKLDGVKKMIDVGGGI 201 Chlorobium tepid...
AAG15232    117 MVPFVDYIADLIENYYLRLADVVRGKVDFTSIVPHPPRTREDSLFYETLHRSNIQLFTELLIKRARLADVQTLIDVGGGI 196 Chloroflexus aur...
tigr:CT0028 101 QTPVAKAMAFLADDFYMGLSQAVRGQKNFKGQVPYPPVTREDNLYFEEIHRSNAKFAIQLLLEEAKLDGVKKMIDVGGGI 180 Chlorobium tepid...
1X19_A      202 GDISAAMLKHFPELDSTILNLPGAIDLVNENAAEKGVADRMRGIAVDIYKESYPEADAVLFCRILYSANEQLSTIMCKKA 281 Chlorobium tepid...
AAG15232    197 GDIAAALCQAFPQLKVTLINLPSALDLVRENVAAKGLADRITPVAIDMYREPYPPGDAVLFSRILYPMNAQFCTMLLRKA 276 Chloroflexus aur...
tigr:CT0028 181 GDISAAMLKHFPELDSTILNLPGAIDLVNENAAEKGVADRMRGIAVDIYKESYPEADAVLFCRILYSANEQLSTIMCKKA 260 Chlorobium tepid...
1X19_A      282 FDAMRSGGRLLILDMVIDDPENPNFDYLSHYILGAGMPFSVLGFKEQARYKEILESLGYKDVTMVR 347 Chlorobium tepidum TLS
AAG15232    277 YDALPSGGRILILDMVISDPNHPNYDYLTHYLCAIGMGFSVLEFKDHAVYPDLLRQVGFTDVTLDE 342 Chloroflexus aurantiacus
tigr:CT0028 261 FDAMRSGGRLLILDMVIDDPENPNFDYLSHYILGAGMPFSVLGFKEQARYKEILESLGYKDVTMVR 326 Chlorobium tepidum TLS
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap