Conserved Protein Domain Family
symport_actP

?
TIGR02711: symport_actP 
cation/acetate symporter ActP
Members of this family belong to the Sodium:solute symporter family. Both members of this family and other close homologs tend to be encoded next to a member of pfam04341, a set of uncharacterized membrane proteins. The characterized member from E. coli is encoded near and cotranscribed with the acetyl coenzyme A synthetase (acs) gene. Proximity to an acs gene was used as one criterion for determining the trusted cutoff for this model. Closely related proteins may differ in function and are excluded by the high cutoffs of this model; members of the family of phenylacetic acid transporter PhaJ can score as high as 1011 bits. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 131758
View PSSM: TIGR02711
Aligned: 4 rows
Threshold Bit Score: 953.986
Threshold Setting Gi: 418555
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D913   4 RFMMLFGLLTLPVLAWAADALTGDVQRQPLNIQAIVMFLLFVGGTLYITYWASKKTRSRSDYYTAGGNITGFQNGLAIAG 83  Pectobacterium atrose...
P32705   2 KRVLTALAATLPFAANAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVRSRSDYYTAGGNITGFQNGLAIAG 81  Escherichia coli K-12
Q8ZJ73   4 RHWSALSLFVLPALAQA-EALTGEVHRQPLNIQAIVMFLLFVGGTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAG 82  Yersinia pestis
Q7NA72   2 KNFLLLAIMLFPHLTWA-NVISETGERQPVNIQAIIMFVLFVGFTLYITYWASKKTRSRTDYYTAGGRITGFQNGMAIAG 80  Photorhabdus luminesc...
Q6D913  84 DYMSAASFLGISALVYTSGYDGLIYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQNPIRSLSACGSLVVVALY 163 Pectobacterium atrose...
P32705  82 DYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALY 161 Escherichia coli K-12
Q8ZJ73  83 DYMSAASFLGISALVYASGYDGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVALY 162 Yersinia pestis
Q7NA72  81 DFMSAASFLGISALVYTSGYDGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRILSAIGSLFVVALY 160 Photorhabdus luminesc...
Q6D913 164 LIAQMVGAGKLIELLFGLNYHVAVVLVGILMVMYVMFGGMLATTWVQIIKAVLLLFGATFMAVMVMKSVGFSFDALFKQA 243 Pectobacterium atrose...
P32705 162 LIAQMVGAGKLIELLFGLNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFSEA 241 Escherichia coli K-12
Q8ZJ73 163 LIAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLSGATFMAIMVMKSVNFNFNTLFSEA 242 Yersinia pestis
Q7NA72 161 LIAQMVGAGKLIELLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAILLLAGATFMALMVMKIVNFNFNTLFKEA 240 Photorhabdus luminesc...
Q6D913 244 MEVHPKGAAIMSPGGLVSDPISALSLGLGLMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFMGYFYFLTFIIGFGAIL 323 Pectobacterium atrose...
P32705 242 MAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFYATGFMGYFYILTFIIGFGAIM 321 Escherichia coli K-12
Q8ZJ73 243 VKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAIL 322 Yersinia pestis
Q7NA72 241 IAVHSRGEAIMSPGGLVSDPISALSLGLALMFGTAGLPHIIMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAIL 320 Photorhabdus luminesc...
Q6D913 324 LVSANPEFKDATGALIGGNNMAAIHLADAVGGNFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYSNVIKKGkATERD 403 Pectobacterium atrose...
P32705 322 LVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVFKKG-ATERE 400 Escherichia coli K-12
Q8ZJ73 323 LVGPNQTFKDAAGALLGGNNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGkANERD 402 Yersinia pestis
Q7NA72 321 LVSPNPSFKDTTGALIGGTNMAAVHLASAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANAIKSGkANERD 400 Photorhabdus luminesc...
Q6D913 404 ELKVSKITVLVLGVVAISLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWSKLTTRGAMIGGWAGLLTAVILMVLGP 483 Pectobacterium atrose...
P32705 401 ELRVSKITVLILGVIAIILGVLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMILGP 480 Escherichia coli K-12
Q8ZJ73 403 ELRVSKITVIILGIVAIGLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWDKLTTRGAMIGGWLGLSTAVILMILGP 482 Yersinia pestis
Q7NA72 401 ELRVSKITVVILGFIAIGLGILFENQNIAFMVGLAFSIAASCNFPIILLSMYWHKLTTRGALVGGWLGLITAVVLMILGP 480 Photorhabdus luminesc...
Q6D913 484 TIWVKILGHAAPIYPYDYPALFSMLVAFIGIWFFSITDRSETGQQERARFHAQFVRSQTGVGASKGSSH 552 Pectobacterium atrosepticum SCRI...
P32705 481 TIWVQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRSQTGFGVEQGRAH 549 Escherichia coli K-12
Q8ZJ73 483 TIWVTILGHEKPIYPYEYPALFSMIAAFVGTWFFSITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH 551 Yersinia pestis
Q7NA72 481 TIWVSILGHEKPIYPYEYPALFSMIIAFIGSWLFSITDNSQQGMQEREQFRIQFIRSQTGLGIAQGKTH 549 Photorhabdus luminescens subsp. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap