1YCO


Conserved Protein Domain Family
branched_ptb

?
TIGR02709: branched_ptb 
Click on image for an interactive view with Cn3D
branched-chain phosphotransacylase
This model distinguishes branched-chain phosphotransacylases like that of Enterococcus faecalis from closely related subfamilies of phosphate butyryltransferase (EC 2.3.1.19) (TIGR02706) and phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651). Members of this family and of TIGR02706 show considerable crossreactivity, and the occurrence of a member of either family near an apparent leucine dehydrogenase will suggest activity on branched chain-acyl-CoA compounds. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131756
View PSSM: TIGR02709
Aligned: 3 rows
Threshold Bit Score: 516.622
Threshold Setting Gi: 60594261
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YCO_A     2 ITVSIAGGSQPEILQLVKKALKEAEQPLQFIVFDTNENLDTENLWKYVHCSDEAAVAQEAVSLVATGQAQILLKGIIQTH 81  Enterococcus faecal...
AAD55374   2 ITVSIAGGSQPEILQLVKKALKEAEQPLQFIVFDTNENLDTENLWKYVHCSDEAAVAQEAVSLVATGQAQILLKGIIQTH 81  Enterococcus faecalis
AAO81441   2 ITVSIAGGSQPEILQLVKKALKEAEQPLQFIVFDTNENLDTENLWKYVHCSDEAAVAQEAVSLVATGQAQILLKGIIQTH 81  Enterococcus faecal...
1YCO_A    82 TLLKEMLKSEHQLKNKPILSHVAMVELPAGKTFLLTDCAMNIAPTQATLIEIVENAKEVAQKLGLHHPKIALLSAAENFN 161 Enterococcus faecal...
AAD55374  82 TLLKEMLKSEHQLKNKPILSHVAMVELPAGKTFLLTDCAMNIAPTQATLIEIVENAKEVAQKLGLHHPKIALLSAAENFN 161 Enterococcus faecalis
AAO81441  82 TLLKEMLKSEHQLKNKPILSHVAMVELPAGKTFLLTDCAMNIAPTQATLIEIVENAKEVAQKLGLHHPKIALLSAAENFN 161 Enterococcus faecal...
1YCO_A   162 PKMPSSVLAKEVTAHFNDQQEATVFGPLSLDLATSEEAVAHKRYSGPIMGDADILVVPTIDVGNCLYKSLTLFGHAKVGG 241 Enterococcus faecal...
AAD55374 162 PKMPSSVLAKEVTAHFNNQQEATVFGPLSLDLATSEEAVAHKRYSGPIMGDADILVVPTIDVGNCLYKSLTLFGHAKVGG 241 Enterococcus faecalis
AAO81441 162 PKMPSSVLAKEVTAHFNDQQEATVFGPLSLDLATSEEAVAHKRYSGPIMGDADILVVPTIDVGNCLYKSLTLFGHAKVGG 241 Enterococcus faecal...
1YCO_A   242 TIVGTKVPVVLTSRSDSTESKFHSLRFAMRQ 272 Enterococcus faecalis V583
AAD55374 242 TIVGTKVPVVLTSRSDSTESKFHSLRFAMRQ 272 Enterococcus faecalis
AAO81441 242 TIVGTKVPVVLTSRSDSTESKFHSLRFAMRQ 272 Enterococcus faecalis V583
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap