Conserved Protein Domain Family

TIGR02709: branched_ptb 
Click on image for an interactive view with Cn3D
branched-chain phosphotransacylase
This model distinguishes branched-chain phosphotransacylases like that of Enterococcus faecalis from closely related subfamilies of phosphate butyryltransferase (EC (TIGR02706) and phosphate acetyltransferase (EC (TIGR00651). Members of this family and of TIGR02706 show considerable crossreactivity, and the occurrence of a member of either family near an apparent leucine dehydrogenase will suggest activity on branched chain-acyl-CoA compounds. [Energy metabolism, Amino acids and amines]
PSSM-Id: 131756
Aligned: 3 rows
Threshold Bit Score: 516.622
Threshold Setting Gi: 60594261
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1YCO_A   242 TIVGTKVPVVLTSRSDSTESKFHSLRFAMRQ 272 Enterococcus faecalis V583
AAD55374 242 TIVGTKVPVVLTSRSDSTESKFHSLRFAMRQ 272 Enterococcus faecalis
AAO81441 242 TIVGTKVPVVLTSRSDSTESKFHSLRFAMRQ 272 Enterococcus faecalis V583
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap