2DU2


Conserved Protein Domain Family
L_lactate_ox

?
TIGR02708: L_lactate_ox 
Click on image for an interactive view with Cn3D
L-lactate oxidase
Members of this protein oxidize L-lactate to pyruvate, reducing molecular oxygen to hydrogen peroxide. The enzyme is known in Aerococcus viridans, Streptococcus iniae, and some strains of Streptococcus pyogenes where it appears to contribute to virulence. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131755
View PSSM: TIGR02708
Aligned: 4 rows
Threshold Bit Score: 698.588
Threshold Setting Gi: 119389267
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DU2_A         7 EYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIK 86  Aerococcus viri...
tigr:SP_0715   2 SYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFTLRENIRAFNHKLIVPHTLCNVENPSTEIEFAGEKLS 81  Streptococcus p...
AAZ50959      17 DFKTSSAEGNVDFINVFDLEKMAQQVIPKGAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDYLT 96  Streptococcus p...
BAA09172       7 EYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIK 86  Aerococcus viri...
2DU2_A        87 APFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGA 166 Aerococcus viri...
tigr:SP_0715  82 SPIIMAPVAAHKLANEQGEVATARGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGY 161 Streptococcus p...
AAZ50959      97 SPLILAPVAAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGGTPHWFQFYYSKDDGINRNIMDRVKAQGC 176 Streptococcus p...
BAA09172      87 APFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGA 166 Aerococcus viri...
2DU2_A       167 TAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRgTAEGMSLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHP 246 Aerococcus viri...
tigr:SP_0715 162 KAIVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLP-EGAGKSMDFVYKSAKQRLSPRDVEFIAEYSGLPVYVKGPQCR 240 Streptococcus p...
AAZ50959     177 KAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLP-DGAGKTMDYVYKSAKQALTSKDIEYIATYSGLPVYVKGPQCA 255 Streptococcus p...
BAA09172     167 TAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRgTAEGMSLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHP 246 Aerococcus viri...
2DU2_A       247 EDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGL 326 Aerococcus viri...
tigr:SP_0715 241 EDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAVDRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGL 320 Streptococcus p...
AAZ50959     256 EDTLRALDAGASGIWVTNHGGRQLDGGPAAFDSLQEVAEAVDQKVPIVFDSGIRRGQHIFKALASGADLVALGRPAIYGL 335 Streptococcus p...
BAA09172     247 EDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGL 326 Aerococcus viri...
2DU2_A       327 ALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY 374 Aerococcus viridans
tigr:SP_0715 321 ALGGSVGVRQVFEHLNAELKTVMQLSGTQTIEDVKHFKLRHNPYNPTF 368 Streptococcus pneumoniae TIGR4
AAZ50959     336 AMGGSIGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSI 383 Streptococcus pyogenes MGAS5005
BAA09172     327 ALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY 374 Aerococcus viridans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap