1X9J


Conserved Protein Domain Family
butyr_kinase

?
TIGR02707: butyr_kinase 
Click on image for an interactive view with Cn3D
butyrate kinase
This model represents an enzyme family in which members are designated either butryate kinase or branched-chain carboxylic acid kinase. The EC designation 2.7.2.7 describes an enzyme with relatively broad specificity; gene products whose context suggests a role in metabolism of aliphatic amino acids are likely to act as branched-chain carboxylic acid kinase. The gene typically found adjacent, ptb (phosphate butyryltransferase), likewise encodes an enzyme that may have a broad specificity that includes a role in aliphatic amino acid cabolism. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 162981
View PSSM: TIGR02707
Aligned: 9 rows
Threshold Bit Score: 616.716
Threshold Setting Gi: 39930884
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1X9J_A   3 RILTINPGSTSTKLSIFEDERMVKMQNFSHSPDELGRFQKILDQLEFREKIARQFVEETGYSLSsFSAFVSRGGLLDPIP 82  Thermotoga maritima MSB8
Q8A4P5   2 KILVINPGSTSTKIAVYENETPLLVRNIKHTVEELSVYPQVIDQFEFRKNLVLQELEANGIPFA-FDAVIGRGGLVKPIP 80  Bacteroides thetaiota...
P54532   9 RILTINPGSTSTKIGVFHNERSIFEKTLRHNIEELQRFDRIIDQYEFRKNHILETLHEQGINISkFDAVCARGGLLRPIE 88  Bacillus subtilis sub...
Q8R832   5 LILVINPGSTSTKVAVFRDKEPVFTETLRHSTEELSKYKRIIDQFEFRTQAILDMLKEKGISLSqIDAIVGRGGLLKPIE 84  Caldanaerobacter subt...
Q890U0   4 KLLIINPGSTSTKIGVFEDENLIFEETLRHSAEEIGKYSNVYEQFPFRKEVILNVLKEKGFDINtLDAIVGRGGLLKPVE 83  Clostridium tetani E88
Q8R828   3 KVLVINPGSTSTKVALYEDEKEIVRSDITHDVETLKNYKSVIEQLDLRLEAINKWLSENGIKVLeLSAIVVRGGLIKPVQ 82  Caldanaerobacter subt...
Q9RPS7   3 TVLVINPGSTSTKLALFANHDCLAEETLRHSVQELAPFENVVSQTSFRKQMIAEFLETH--NIIqLAAVVGRGGLLKPIP 80  Enterococcus faecalis...
Q8Y7B6   4 DVLTINPGSTSTKLAVYQGDKVLFEETVRHTMQELADFNNVQEQFDFRWQVLRRVMDAHGYDVKkLQAVVGRGGLLRPVA 83  Listeria monocytogene...
Q9X278   3 RILTINPGSTSTKLSIFEDERMVKMQNFSHSPDELGRFQKILDQLEFREKIARQFVEETGYSLSsFSAFVSRGGLLDPIP 82  Thermotoga maritima MSB8
1X9J_A  83 GGVYLVDGLMIKTLKSGKNgEHASNLGAIIAHRFSSETG-VPAYVVDPVVVDEMEDVARVSGHPNYQRKSIFHALNQKTV 161 Thermotoga maritima MSB8
Q8A4P5  81 GGVYAVNEAMKQDTLHAMR-THACNLGGLIAAELAASLPdCPAFIADPGVVDELEDVARISGSPLMPKITIWHALNQKAI 159 Bacteroides thetaiota...
P54532  89 GGTYVVNDEMIEDLKSGYAgQHASNLGGIIAREIADGLN-IPSYIVDPVVVDEMSVLAKVSGMPEIERKSIFHALNQKAV 167 Bacillus subtilis sub...
Q8R832  85 SGTYIVNEKMLEDLKKAERgEHASNLGAIIAYTLAKEHN-IPAYIVDPVVVDELEDVARITGLPEIEKQSIFHALNQKAI 163 Caldanaerobacter subt...
Q890U0  84 GGTYEVNDAMLKDLRESVRgEHASNLGGIIGNEIAKSLN-IPAFIVDPVVVDELQDIARISGMPEIERTSIFHALNQKAV 162 Clostridium tetani E88
Q8R828  83 SGTYVVNDIMLEDLRKGVGgEHPSNLGGIIGRALADPYG-IPVYTLDPVAVDEMEDVARISGLPELPRKSQSHALNIKAC 161 Caldanaerobacter subt...
Q9RPS7  81 GGTYLVDQQMLEDLRTERFnTHASNLGAILANEFAEKYH-VPAFIVDPVVVDELQPLARISGLKGIQRRSVGHALNQKAV 159 Enterococcus faecalis...
Q8Y7B6  84 GGTYMVTEKMIDDLKENKYgEHASNLGAMLAKKLADELT-IPSFIVDPVVVDEMQEIARISGNAFVTRKSIFHALNHKAA 162 Listeria monocytogene...
Q9X278  83 GGVYLVDGLMIKTLKSGKNgEHASNLGAIIAHRFSSETG-VPAYVVDPVVVDEMEDVARVSGHPNYQRKSIFHALNQKTV 161 Thermotoga maritima MSB8
1X9J_A 162 AKEVARMMNKRYEEMNLVVAHMGGGISIAAHRKGRVIDVNNALDGDGPFTPERSGTLPLTQLVDLCFSGKFTYEEMKKRI 241 Thermotoga maritima MSB8
Q8A4P5 160 ARRFAKEQGTKYEELDLIICHLGGGISIAVHQHGKAIDANNALDGEGPFSPERAGTLPAGQLIDICYSGQFTKDELKKRI 239 Bacteroides thetaiota...
P54532 168 ARKAAASLGKRYENMKMIITHMGGGITIGVHDRGRVVDVNNGLHGEGPFSPERAGTVPAGDLVDLCFSGEYTKEEIMKKL 247 Bacillus subtilis sub...
Q8R832 164 ARRLASDLGKRYDEVNLIIAHLGGGISVGAHRKGRVIDVNDALNGEGPFSPERAGGLPVLDLVKLCYSGKYTFEEMKKKL 243 Caldanaerobacter subt...
Q890U0 163 ARRYAKENNKSYEDVNIVVVHMGGGSSVGAHKNGKIIDVNNALDGEGPFSPERSGGVPIGDLVRLCYSGKYTLDEIIKKI 242 Clostridium tetani E88
Q8R828 162 IHRYARENNLKEEELNMIVAHMGGGISVAAIKGGRIVDVNNANQ-MGPFSPERTGSLPSMKVVEMCYSGKYTLEEMKKKI 240 Caldanaerobacter subt...
Q9RPS7 160 ARKIAEDLGKTYEQSNFIVVHLGGGISLGAHQKGRMVDVVNGLDGEGPYTPERSGALPLVEFAQWILEQELTISQVKKLI 239 Enterococcus faecalis...
Q8Y7B6 163 GRKIAKELGKDYEKMNFVIAHLGGGISVAAHRQGKAVDVNNALDGDGPFSPERSGSLPMNDFLEACFSGKWTKRELHELI 242 Listeria monocytogene...
Q9X278 162 AKEVARMMNKRYEEMNLVVAHMGGGISIAAHRKGRVIDVNNALDGDGPFTPERSGTLPLTQLVDLCFSGKFTYEEMKKRI 241 Thermotoga maritima MSB8
1X9J_A 242 VGNGGLVAYLGTSDAREVVRRIKQGDEWAKRVYRAMAYQIAKWIGKMAAVLKGEVDFIVLTGGLAHEKE-FlVPWITKRV 320 Thermotoga maritima MSB8
Q8A4P5 240 SGRAGLTAHLGTTDVPAIIKAIEEGDKKAELILDAMIYNVAKAIGGAATVLCGKVDAILLTGGIAYSDY-I-ISRLKKRI 317 Bacteroides thetaiota...
P54532 248 VGTGGLLGYLGTNDAVKVEQMIQGGDEKARFIYDAMAYQVAKEIGAASAALKGEVEAIVLTGGLAYGKS-F-VSAIRSYI 325 Bacillus subtilis sub...
Q8R832 244 IGKGGIVAHLGTNDVREVYKMIENGDKNAELILDAMAYQTAKEIGSMAVVLKGKVDAIGITGGIAHNED-F-VRRIRERV 321 Caldanaerobacter subt...
Q890U0 243 NGKGGAVAYLGTNDFREVEEKALAGDEKYKLILDAFIYQISKEIGKCSVVLEGNVDAIVLTGGIAYSKY-V-TKEIENKV 320 Clostridium tetani E88
Q8R828 241 VGMGGLVAHLGTNDAREVVKRIEAGDKKAKLVFEAMAYQIAKEIGRMAAVLKGDVKTIILTGGLAYSKP-L-IEIIIDMV 318 Caldanaerobacter subt...
Q9RPS7 240 AGNSGLKSYLGETDLRHIQAQIAAGDQTANYYLKGMCYQIAKSIGEMAVVLEGTIDAIILTGGAAYSQT-V-VQEISQKV 317 Enterococcus faecalis...
Q8Y7B6 243 VGRGGMISYLGTNSMLEVEAKVQAGEEKAIEAFDAMAYQVSKEIGACSVVLQGKVDAIILTGGLARSEL-F-TSKIIEQT 320 Listeria monocytogene...
Q9X278 242 VGNGGLVAYLGTSDAREVVRRIKQGDEWAKRVYRAMAYQIAKWIGKMAAVLKGEVDFIVLTGGLAHEKEfL-VPWITKRV 320 Thermotoga maritima MSB8
1X9J_A 321 SFIAPVLVFPGSNEEKALALSALRVLRGEEKPKN 354 Thermotoga maritima MSB8
Q8A4P5 318 SFLAPIHVYPGEGEMESLAFNALGALRGELPVQI 351 Bacteroides thetaiotaomicron VPI-5482
P54532 326 DWISDVLVYPGENELQSLAQGALRVLQGEEQSKQ 359 Bacillus subtilis subsp. subtilis str. 168
Q8R832 322 EFIAPVYVYPGEDEMLALAEGAYRVLTGEENPKT 355 Caldanaerobacter subterraneus subsp. tengcongensis MB4
Q890U0 321 KFIAPVVLYPGEDELLALTQGGLRVLNGEEKAKE 354 Clostridium tetani E88
Q8R828 319 GFIAPITLYPGGDEMEALRDGALRVLRGQETPKI 352 Caldanaerobacter subterraneus subsp. tengcongensis MB4
Q9RPS7 318 TWIAPIKVYPGEMEMAALYEGVNRVLTGEEQALN 351 Enterococcus faecalis V583
Q8Y7B6 321 NWITSVIIEPGEDELEALNSGVQRVLAGLEKEKE 354 Listeria monocytogenes EGD-e
Q9X278 321 SFIAPVLVFPGSNEEKALALSALRVLRGEEKPKN 354 Thermotoga maritima MSB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap