
Conserved Protein Domain Family

TIGR02707: butyr_kinase 
Click on image for an interactive view with Cn3D
butyrate kinase
This model represents an enzyme family in which members are designated either butryate kinase or branched-chain carboxylic acid kinase. The EC designation describes an enzyme with relatively broad specificity; gene products whose context suggests a role in metabolism of aliphatic amino acids are likely to act as branched-chain carboxylic acid kinase. The gene typically found adjacent, ptb (phosphate butyryltransferase), likewise encodes an enzyme that may have a broad specificity that includes a role in aliphatic amino acid cabolism. [Energy metabolism, Fermentation]
PSSM-Id: 162981
Aligned: 9 rows
Threshold Bit Score: 616.716
Threshold Setting Gi: 39930884
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q8A4P5 318 SFLAPIHVYPGEGEMESLAFNALGALRGELPVQI 351 Bacteroides thetaiotaomicron VPI-5482
P54532 326 DWISDVLVYPGENELQSLAQGALRVLQGEEQSKQ 359 Bacillus subtilis subsp. subtilis str. 168
Q8R832 322 EFIAPVYVYPGEDEMLALAEGAYRVLTGEENPKT 355 Caldanaerobacter subterraneus subsp. tengcongensis MB4
Q8R828 319 GFIAPITLYPGGDEMEALRDGALRVLRGQETPKI 352 Caldanaerobacter subterraneus subsp. tengcongensis MB4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap