Conserved Protein Domain Family
P_butyryltrans

?
TIGR02706: P_butyryltrans 
phosphate butyryltransferase
Members of this family are phosphate butyryltransferase, also called phosphotransbutyrylase. In general, this enzyme is found in butyrate-producing anaerobic bacteria, encoded next to the gene for butyrate kinase. Together, these two enzymes represent what may be the less common of two pathways for butyrate production from butyryl-CoA. The alternative is transfer of the CoA group to acetate by butyryl-CoA:acetate CoA transferase. Cutoffs for this model are set such that the homolog from Thermotoga maritima, whose activity on butyryl-CoA is only 30 % of its activity with acetyl-CoA, scores in the zone between trusted and noice cutoffs. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 162980
View PSSM: TIGR02706
Aligned: 7 rows
Threshold Bit Score: 450.356
Threshold Setting Gi: 251757310
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAR19757   5 FEDLLAKVAKCSKKTVSVACAQDKPVLEAVKAAKEKGIADAILVGDEAEIRKIAAELDMN-LDEYKIINEPDSIQAAHKA 83  butyrate-producing ...
BAB82054  32 FNELFSKLRENGMKKVSVAVAQDEPVLEAVREAKELGIAEAVLVGNEEKIKEIAKKIGMN-LADFEIINEPNDKKAALLA 110 Clostridium perfrin...
Q05624     5 FDELLSRLKEVPTKKVAVAVAQDEPVLEAIKEATENNIAQAILVGDKQQIHEIAKKINLD-LSDYEIMDIKDPKKATLEA 83  Clostridium beijeri...
P58255     5 FNEIIMKVKSKEMKKVAVAVAQDEPVLEAVRDAKKNGIADAILVGDHDEIVSIALKIGMD-VNDFEIVNEPNVKKAALKA 83  Clostridium acetobu...
AAM25359   4 FAELYEHVKNLPPKVIAVAQAADEDVLEAIKEAHEKGIVRAILVGDKEKIERIASSIGMS-LKDHEIVEAKSNLDACREA 82  Caldanaerobacter su...
BAD11092   3 LETLIEEASQCQGRTVAVAAAEDEEVVEAVAMALEHRLGRFVLYGDRERIGRLLKEKGGArFDDVDIVHANSVVQAAELA 82  Geobacillus thermoc...
P54530     3 LKDLIGKASIHKNKTIAVAHAEDEEVIRAVKLAAEHLSARFLLTGDSKKLNELTSSMQG---HQVEIVHANTPEESAKLA 79  Bacillus subtilis s...
AAR19757  84 VELVHNNKADMYMKGIIDTKNFLKSVLDKEVGLRTGKPLSHVAVFEVPGVDRLLYLSDVAFMTYPSLEDKKAIIENTVKV 163 butyrate-producing ...
BAB82054 111 VELASTGKTDMVMKGLVDTATFLRSVLNKEVGLRTGQLMSHVSVFEIPGMDRLLFLTDAAFNTYPELKDKSSMINNSVKV 190 Clostridium perfrin...
Q05624    84 VKLVSSGHADMLMKGLVDTATFLRSVLNKEVGLRTGKLMSHVAVFDVEGWDRLLFLTDAAFNTYPEFKDKVGMINNAVVV 163 Clostridium beijeri...
P58255    84 VELVSTGKADMVMKGLVNTATFLRSVLNKEVGLRTGKTMSHVAVFETEKFDRLLFLTDVAFNTYPELKEKIDIVNNSVKV 163 Clostridium acetobu...
AAM25359  83 VRLVSEGKADILMKGLVQTAEILRVVLDKEIGLRTGRTLSHVAVFESP-YNRLILLTDAAMNIAPDLKVKIDIILNAIDV 161 Caldanaerobacter su...
BAD11092  83 VRAVHLNEADALMKGHVPTATLLKAVLNKEYGLRTGKVLSHVAVFDVPEFERLVIVTDAAMNIAPDLEQKVQLVNNAVSI 162 Geobacillus thermoc...
P54530    80 VRAVHHKTADVLMKGNVPTSVLLKAVLNRQEGLRSASVLSHVAVFDIPDFDRLMFVTDSAMNIAPSLEELRQILQNAVHV 159 Bacillus subtilis s...
AAR19757 164 VHACGIPCPKVAPLAAVEVVNPKMPVTVDAAELTKMNENGEITGCIVDGPLSLDLAIDPEAAKHKGAEDrKIVGDADILL 243 butyrate-producing ...
BAB82054 191 AHACGVQVPKVAVIGAVEVVNPNMPATIDAALLAKMNDRGQIKGCIVDGPFALDNAISEEAAEHKGVKG-EVAGKADILL 269 Clostridium perfrin...
Q05624   164 AHACGIDVPRVAPICPVEVVNTSMQSTVDAALLAKMSDRGQIKGCVIDGPFALDNAISEEAAHHKGVTG-SVAGKADILL 242 Clostridium beijeri...
P58255   164 AHAIGIENPKVAPICAVEVINPKMPSTLDAAMLSKMSDRGQIKGCVVDGPLALDIALSEEAAHHKGVTG-EVAGKADIFL 242 Clostridium acetobu...
AAM25359 162 ARQIGIDAPRVAILGAVETVNPDMQATLDAAILSKMSERGQIKGAIIDGPLALDNALSVEAARHKGIVS-PVAGNADILV 240 Caldanaerobacter su...
BAD11092 163 ARSIGIERPKVAVLVAIETVNPGMPATVDAAALAMMQKRGQIEHCLLDGPLALDNAVSMTAAKHKRIES-EVAGQADILL 241 Geobacillus thermoc...
P54530   160 AHAVGNNMPKAAALAAVETVNPKMEATVNAAALAQMYKRGQIKGCIVDGPLALDNAVSQIAAAQKKISG-DVAGNADILL 238 Bacillus subtilis s...
AAR19757 244 FPDIHAGNLVYKCLTHTTASKNGCILTGTKAPVILTSRSDSFEVKMNSIALAAVVA 299 butyrate-producing bacterium L2-50
BAB82054 270 LPNIDVANVMYKTLTYMSECKNGGLLVGTSSPVILTSRADSFETKVKSIAIAAVVA 325 Clostridium perfringens str. 13
Q05624   243 LPNIEAANVMYKTLTYFSKSRNGGLLVGTSAPVILTSRADSFETKVNSIALAALVA 298 Clostridium beijerinckii NCIMB 8052
P58255   243 MPNIETGNVMYKTLTYTTDSKNGGILVGTSAPVVLTSRADSHETKMNSIALAALVA 298 Clostridium acetobutylicum ATCC 824
AAM25359 241 VPDIEAGNILYKAITYIAQRKIAGIIMGAKKPIVLTSRADSSDAKFNSIMLASLAS 296 Caldanaerobacter subterraneus subsp. tengco...
BAD11092 242 VPDIESGNMLYKSLVYLAKAKVGAVIAGAKAPIVLTSRADSAESKLYSLALAICSA 297 Geobacillus thermocatenulatus
P54530   239 VPTIEAGNILYKSLIYFAKASVAAVITGAKAPIALTSRADSAENKLYSIALAICAS 294 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap