Conserved Protein Domain Family

TIGR02706: P_butyryltrans 
phosphate butyryltransferase
Members of this family are phosphate butyryltransferase, also called phosphotransbutyrylase. In general, this enzyme is found in butyrate-producing anaerobic bacteria, encoded next to the gene for butyrate kinase. Together, these two enzymes represent what may be the less common of two pathways for butyrate production from butyryl-CoA. The alternative is transfer of the CoA group to acetate by butyryl-CoA:acetate CoA transferase. Cutoffs for this model are set such that the homolog from Thermotoga maritima, whose activity on butyryl-CoA is only 30 % of its activity with acetyl-CoA, scores in the zone between trusted and noice cutoffs. [Energy metabolism, Fermentation]
PSSM-Id: 162980
Aligned: 7 rows
Threshold Bit Score: 450.356
Threshold Setting Gi: 251757310
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
AAM25359 241 VPDIEAGNILYKAITYIAQRKIAGIIMGAKKPIVLTSRADSSDAKFNSIMLASLAS 296 Caldanaerobacter subterraneus subsp. tengco...
P54530   239 VPTIEAGNILYKSLIYFAKASVAAVITGAKAPIALTSRADSAENKLYSIALAICAS 294 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap