Conserved Protein Domain Family
nudix_YtkD

?
TIGR02705: nudix_YtkD 
nucleoside triphosphatase YtkD
The functional assignment to the proteins of this family is contentious, with papers disagreeing in both interpretation and enzyme assay results. This protein belongs to the nudix family and shares some sequence identity with E. coli MutT but appears not to be functionally interchangeable with it. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131752
View PSSM: TIGR02705
Aligned: 7 rows
Threshold Bit Score: 231.495
Threshold Setting Gi: 56381235
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD65418           2 EQFIDPQGQKVKLVLGKEErFTEEAGHVLVLPRFQQQWVLTEHRDRGYEFPGGKVENGETTKDAAIREVWEETGAHIGTI 81  Bacillus cl...
BAB07027           2 DVFNDYYGYPVRLAFDSTP-FSINPRHVWVICHMDGQWLLTNHKKRGLEFPGGKVEHGETPEAAAIREVKEETGATVRSL 80  Bacillus ha...
BAD77143           2 HEFRDYYGHRVRLAFADHP-FSPSPGHVWVICRYGGRWLLTDHPRRGLEFPGGKVEEGETAAEAAAREVMEETGGIVGRL 80  Geobacillus...
jgilanl:BCZK4541   2 YKFKDYYHNTVQLSFERYP-FSPEPKHVWVVCRYGDQWLLTHHLRRGLEFPGGKVELGETPEEAAVREVHEETGGIVSDL 80  Bacillus ce...
CAC99747           2 FIYIDTLGNKVTIYFEAQE---NNPDDVLIIPKTKDGWLFTEHKIRGLEFPGGKGEPGETNLDAAKRELMEETGAISAEL 78  Listeria mo...
CAG43518           3 VKFRDKDNRQVNLTFKKDN-EIADGNHVLAIPTFKNQLLFTKHNLRGIEFPGGKRERGESSAEAVTRELYEETGAKVKNI 81  Staphylococ...
AAO05060           4 VEFEDKDGRIVTLNYKNEN-DMPNGNHVLAIPVYNNQLLFTNHQHRGIEFPGGKVEISEQSKEAVIRELYEETGAIAKFI 82  Staphylococ...
BAD65418          82 VYIGQYQVEGQSgTSFCKDIFAGIVTDMEEKDCYKETKGPLLLKELPAALKEDPRFSFIMKDEVVPKATAYAIGQGIL 159 Bacillus clau...
BAB07027          81 TFLGQYEVTLPS-ERIVKNIYAADVQALSSRNSYYETNGPVKIAELPEAIEKDPSFSFIMKDLVLRKTLDYLKRKQLF 157 Bacillus halo...
BAD77143          81 EYIGQYEVEP----DIVKNMYFADIAALVERGSYLETNGPVLLEALPDDIRADQRFSYFMKDDVLSLALAKLKQRGLI 154 Geobacillus k...
jgilanl:BCZK4541  81 TYLGQYKVSGKD-KIIIKNIYFATISAVEQHTHYEETKGSVLLTDIPDNIKTDRKFSFIMRDDVLARTMKHIEEIGCF 157 Bacillus cere...
CAC99747          79 HFVADYLVESEE-RTFTKRVYAAHVISIESLDDYLETKGPVIIQGELSQFILQPAFSFFMRDAGMIQIVQQAEHILND 155 Listeria mono...
CAG43518          82 HYIAQYTIETHDqTDFVKDVYFIEVESLVSKNDYLETAGPVLFNCINDIELAQR--SFLLQDSTILKCVERVQSLGFY 157 Staphylococcu...
AAO05060          83 YYFAQYSIKMGHdEPFIKDVYFVEVSHLEYVDTYYETLGPCLYHQINDIPLNKR--SFLINDKAILHCLERVKTLGFY 158 Staphylococcu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap